MYBL1 Antibody

What is MYBL1 and why is it significant in research?

MYBL1 (MYB proto-oncogene like 1) is a transcription factor that specifically recognizes the DNA sequence 5'-YAAC[GT]G-3'. In humans, the canonical protein has 752 amino acid residues with a molecular mass of 85.9 kDa and is primarily localized in the nucleus . MYBL1 is expressed in various lymphoid and solid tumor cell lines cultured in vitro and has been identified as a potential biomarker in several cancer types .

The scientific significance of MYBL1 stems from its role in:

• Transcriptional regulation of genes involved in cell proliferation

• Cancer development, particularly in triple-negative breast cancer (TNBC)

• Regulation of downstream targets such as VCPIP1, with implications for cancer progression

• Potential as a biomarker for immunotherapy response in clear cell renal cell carcinoma (ccRCC)

MYBL1 is also known by several synonyms including AMYB, myb-related protein A, myb-like protein 1, v-myb avian myeloblastosis viral oncogene homolog-like 1, and A-MYB .

What are the most common applications for MYBL1 antibodies?

MYBL1 antibodies serve as versatile tools in molecular and cellular research with several validated applications:

The Electrophoretic Mobility Shift Assay (EMSA) is another critical application where MYBL1 protein is used to demonstrate binding to specific DNA sequences, such as the VCPIP1 promoter region . This technique has been instrumental in establishing MYBL1's direct regulatory relationship with target genes.

How should I select the appropriate MYBL1 antibody for my specific research needs?

Selecting the optimal MYBL1 antibody requires careful consideration of several technical factors:

Target Specificity Considerations:

• Determine whether you need to detect all MYBL1 isoforms or target specific variants (e.g., exon 15-containing isoforms in TNBC research)

• For isoform-specific detection, choose antibodies targeting unique regions like exon 15

• Review the immunogen sequence provided by manufacturers to ensure it matches your region of interest

Experimental Application Compatibility:

• Verify antibody validation for your intended application (WB, ELISA, IHC)

• Consider specialized applications like ChIP when studying MYBL1's transcription factor activity

• Review published literature using similar methodologies

Species Reactivity:

• Ensure compatibility with your experimental model (human, mouse, rat, etc.)

• MYBL1 orthologs have been reported in mouse, rat, bovine, frog, zebrafish, chimpanzee, and chicken species

Antibody Format Selection:

• Consider conjugated antibodies (biotin, FITC) for specialized applications

• For multi-color flow cytometry or immunofluorescence, fluorophore-conjugated antibodies may be preferable

A methodical approach to antibody selection will significantly enhance experimental reproducibility and reliability.

What validation protocols should I employ for MYBL1 antibodies?

Comprehensive validation of MYBL1 antibodies is essential for generating reliable experimental data. Follow these methodological approaches:

Essential Validation Steps:

• Positive and Negative Controls

  • Use cell lines with known MYBL1 expression (e.g., MDA-MB-231 for high expression)

  • Include negative controls such as MCF10A non-tumor breast cells (lower expression)

  • Consider MYBL1 knockdown samples using shRNA as specificity controls

• Western Blot Validation

  • Verify correct molecular weight (85.9 kDa for canonical protein)

  • Full-length MYBL1 with exon 15 appears at approximately 85,000 Daltons

  • Use the Precision Plus Protein™ Dual Color Standard for accurate sizing

• Specificity Testing

  • Perform peptide competition assays

  • Compare results with multiple antibodies targeting different epitopes

  • For custom antibodies targeting specific regions (e.g., exon 15), verify isoform specificity

• Cross-Reactivity Assessment

  • Test for potential cross-reactivity with related MYB family proteins

  • Evaluate in your specific experimental system and tissue types

Following these validation protocols ensures confidence in experimental findings and facilitates reproducibility across laboratories.

What are the technical considerations for optimizing Western blot detection of MYBL1?

Optimizing Western blot protocols for MYBL1 detection requires attention to several technical parameters:

Sample Preparation:

• For nuclear proteins like MYBL1, use nuclear extraction protocols

• Include protease inhibitors to prevent degradation

• Standardize protein quantification methods (Bradford or BCA)

Gel Electrophoresis Parameters:

• Use 8-10% SDS-PAGE gels for optimal resolution of the 85.9 kDa MYBL1 protein

• Consider gradient gels (4-15%) if detecting multiple isoforms

• Include molecular weight markers covering the 75-100 kDa range

Transfer and Detection Optimization:

• For large proteins, use wet transfer methods with methanol-containing buffers

• Based on published protocols, commercial MYBL1 antibodies are typically used at 1:200 dilution

• Secondary HRP-conjugated antibodies (anti-mouse or anti-rabbit) at 1:1000 dilution

• Develop using ECL substrate (e.g., Clarity Western ECL substrate)

• Consider digital imaging systems (e.g., LI-COR) for quantitative analysis

These technical optimizations will help achieve consistent and reproducible detection of MYBL1 protein in experimental samples.

How can I distinguish between different MYBL1 isoforms using specific antibodies?

Differentiating between MYBL1 isoforms requires strategic antibody selection and experimental design:

Isoform-Specific Antibody Approaches:

• Up to two different isoforms have been reported for MYBL1

• Custom antibodies can be generated against specific regions like exon 15

• The amino acid sequence for exon 15 (ENRFTTSLLMIPLLEIHDNRCNLIPEKQDINSTNKTYTLTKKKPNPNTSKVVKLEKNLQS) can serve as an immunogen for generating isoform-specific antibodies

Experimental Design Strategy:

• Combined Antibody Approach

  • Use both commercial antibodies (recognizing exon 15 plus flanking regions) and custom antibodies (specific to the 60 amino acids of exon 15)

  • Compare expression patterns to identify isoform-specific signals

• Complementary Transcript Analysis

  • Design PCR primers to specifically amplify exon 15-containing transcripts

  • Correlate protein detection with transcript expression

  • The corresponding amplicon for exon 15 is 212 nucleotides

• Validation Through Genetic Manipulation

  • Use isoform-specific siRNA knockdown

  • Overexpress specific isoforms as positive controls

Research has demonstrated that exon 15-containing MYBL1 isoforms are overexpressed in triple-negative breast cancer cell lines compared to non-tumor breast cells, highlighting the biological significance of isoform-specific detection .

What methodologies are recommended for studying MYBL1's transcription factor activity?

As a transcription factor, MYBL1 regulates gene expression by binding to specific DNA sequences. The following methodological approaches are effective for investigating its transcriptional activity:

DNA Binding Assays:

• Electrophoretic Mobility Shift Assay (EMSA)

  • Demonstrated MYBL1 binding to the VCPIP1 promoter region (~940 nucleotides upstream of start site)

  • Use purified MYBL1 recombinant protein with biotin end-labeled DNA probes

  • Include cold unlabeled probes as competition controls

  • Look for shift in mobility indicating protein-DNA complex formation

Chromatin Immunoprecipitation:

• ChIP assays allow identification of genomic regions bound by MYBL1 in vivo

• Use antibodies validated specifically for ChIP applications

• Design primers targeting putative binding sites containing the consensus sequence (5'-YAAC[GT]G-3')

Gene Expression Analysis Following MYBL1 Manipulation:

• Knockdown studies have shown that reduction of MYBL1 in MDA-MB-231 cells leads to downregulation of VCPIP1 expression

• Use RT-qPCR to quantify changes in target gene expression

• RNA-seq can identify genome-wide transcriptional targets

Functional Validation:

• Reporter gene assays with putative MYBL1 binding sites

• Mutagenesis of binding sites to confirm sequence specificity

• CRISPR-based approaches to modify endogenous binding sites

These complementary approaches provide a comprehensive understanding of MYBL1's role as a transcriptional regulator in various biological contexts.

How can I design ChIP experiments to investigate MYBL1 binding to genomic targets?

Chromatin immunoprecipitation (ChIP) is a powerful technique for investigating MYBL1-DNA interactions in vivo. Here's a methodological approach for successful ChIP experiments:

Antibody Selection for ChIP:

• Choose ChIP-validated MYBL1 antibodies

• Prefer antibodies recognizing native (non-denatured) MYBL1

• Consider epitope accessibility when MYBL1 is bound to chromatin

Optimized ChIP Protocol for MYBL1:

• Cross-linking: Fix cells with 1% formaldehyde (10 minutes at room temperature)

• Chromatin preparation: Sonicate to generate 200-500 bp fragments

• Immunoprecipitation: Incubate chromatin with MYBL1 antibody overnight at 4°C

• Washing and elution: Use stringent washing to reduce background

• Reversal of cross-links and DNA purification

Target Site Selection:

• Include known MYBL1 binding regions as positive controls

• Design primers for the VCPIP1 promoter region (~940 nucleotides upstream of start site)

• Target regions containing the MYBL1 consensus sequence (5'-YAAC[GT]G-3')

Advanced ChIP Applications:

• ChIP-seq: For genome-wide mapping of all MYBL1 binding sites

• ChIP-reChIP: To identify regions co-bound by MYBL1 and other transcription factors

• CUT&RUN: Alternative to traditional ChIP with potentially higher signal-to-noise ratio

Data Analysis and Interpretation:

• Calculate enrichment relative to input and IgG controls

• For ChIP-seq, use bioinformatic tools to identify enriched regions and motifs

• Integrate with gene expression data to identify functional binding events

These approaches allow researchers to map MYBL1 binding sites across the genome and understand its transcriptional regulatory network.

What does current research reveal about MYBL1's role in triple-negative breast cancer?

Recent investigations have uncovered significant insights into MYBL1's role in triple-negative breast cancer (TNBC):

Differential Expression Patterns:

• Exon 15 of MYBL1 is differentially overexpressed in TNBC cell lines (MDA-MB-436 and MDA-MB-231) compared to non-tumor estrogen receptor-negative MCF10A cells

• Both transcript and protein analyses confirm this overexpression pattern

• This suggests that specific MYBL1 isoforms containing exon 15 may play a role in TNBC biology

Molecular Regulatory Mechanisms:

• Knockdown of MYBL1 in MDA-MB-231 cells leads to downregulation of VCPIP1 gene expression

• EMSA experiments demonstrate direct binding of MYBL1 protein to the VCPIP1 promoter

• This establishes a MYBL1-VCPIP1 regulatory axis in TNBC

Experimental Approaches Used:

• PCR primers designed to specifically amplify the exon 15 region (212 nucleotide amplicon)

• Protein expression analyzed using both commercial and custom antibodies targeting the exon 15 region

• Western blotting identified an 85,000 Dalton protein band corresponding to full-length MYBL1 with exon 15

Implications for TNBC Research:

• The specific overexpression of MYBL1 exon 15-containing isoforms suggests potential as a diagnostic biomarker

• The MYBL1-VCPIP1 regulatory relationship represents a possible therapeutic target

• Understanding the molecular mechanisms of MYBL1's contribution to TNBC may lead to novel treatment strategies

These findings highlight MYBL1's significance in TNBC biology and suggest further avenues for investigation in diagnosis and treatment of this aggressive breast cancer subtype.

What techniques can demonstrate MYBL1 binding to specific promoter regions?

Investigating MYBL1's interaction with specific promoter regions requires a combination of in vitro and in vivo techniques:

In Vitro Binding Analysis:

• Electrophoretic Mobility Shift Assay (EMSA)

  • Successfully used to demonstrate MYBL1 binding to VCPIP1 promoter

  • Design biotin end-labeled DNA probes containing putative binding sites

  • Use purified MYBL1 recombinant protein for binding experiments

  • Include competition controls with unlabeled probes to demonstrate specificity

Protocol for EMSA with MYBL1:

• Incubate biotin-labeled DNA probe with purified MYBL1 protein

• Without MYBL1, the probe migrates as a low-molecular-weight band

• When bound to MYBL1, a shift in mobility occurs, showing higher-molecular-weight migration

• Cold unlabeled probes can compete with labeled probes, reducing the shift signal

In Vivo Binding Verification:

• Chromatin Immunoprecipitation (ChIP)

  • Provides evidence of MYBL1 binding in the cellular context

  • Design PCR primers flanking the putative binding site

  • Use MYBL1 antibodies validated for ChIP applications

  • Quantify enrichment by qPCR relative to input and IgG controls

Case Study: VCPIP1 Promoter Binding

EMSA experiments have demonstrated that purified MYBL1 protein binds to a specific sequence in the VCPIP1 promoter region approximately 940 nucleotides upstream of the start site . This binding correlates with functional regulation, as MYBL1 knockdown leads to decreased VCPIP1 expression .

Functional Validation Approaches:

• Reporter gene assays with wild-type and mutated binding sites

• Gene expression analysis following MYBL1 knockdown or overexpression

• CRISPR-based approaches to modify endogenous binding sites

By combining these complementary techniques, researchers can comprehensively characterize MYBL1's interaction with specific promoter regions and understand its transcriptional regulatory role.