abracl Antibody

What is ABRACL and why is it significant in cellular research?

ABRACL is a small, non-typical winged-helix protein that shares structural similarity with the C-terminal domain of ABRA (Actin-Binding Rho-Activating protein). Its significance in cellular research stems from its implicated roles in multiple critical cellular processes. ABRACL has been shown to influence cell proliferation, particularly in cancer cells where its upregulation has been observed in patients with endometrial, bladder, and gastric tumors . Additionally, it plays roles in cell migration and invasion, likely through modulation of actin dynamics . ABRACL has also been detected in the primary cilium according to proteomic studies, suggesting potential involvement in ciliary functions . From a developmental perspective, ABRACL expression patterns in the developing brain indicate potential roles in neurogenesis and neural migration, making it relevant for developmental neurobiology research . Understanding ABRACL function could provide insights into both normal cellular processes and disease mechanisms, particularly in cancer biology.

How can researchers validate the specificity of commercially available ABRACL antibodies?

Validating antibody specificity is crucial for generating reliable experimental data. For ABRACL antibodies, researchers should implement a multi-step validation approach:

• Cross-reference with RNA expression data: Compare antibody staining patterns with known mRNA expression patterns from techniques like in situ hybridization or RNA-seq. Notably, research has shown that ABRACL protein may have a broader expression domain compared to its mRNA, particularly in developing brain tissue .

• Knockout/knockdown controls: Use shRNA-mediated knockdown samples as negative controls. Specific shRNA sequences targeting ABRACL (e.g., 5'-GCTGATGGAAAGTTAAGCGTG-3' and 5'-GCCAACCTCTTTGAAGCATTG-3') have been successfully employed to reduce ABRACL expression in cell lines like MCF-7 .

• Epitope analysis: Confirm the antibody's target epitope corresponds to unique regions of ABRACL. Available antibodies like the one from ATLAS Antibodies (HPA030217) target a specific immunogen sequence: NVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVTYPGELLLQGVHDDVDIILLQD .

• Multiple antibody comparison: When possible, compare results using different antibodies targeting distinct epitopes of ABRACL to enhance confidence in specificity.

• Western blot analysis: Confirm the antibody detects a protein of the expected molecular weight (approximately 10 kDa for ABRACL) without significant non-specific bands.

What are the recommended applications and working dilutions for ABRACL antibodies?

Based on validated protocols, ABRACL antibodies can be effectively used in several applications with specific recommended dilutions:

For optimal results in Western blot applications, researchers should use RIPA buffer for protein extraction, perform protein quantification using BCA assays, and separate proteins using standard SDS-PAGE before transferring to PVDF membranes . Detection can be accomplished using enhanced chemiluminescence systems followed by analysis with imaging software such as Image Lab .

What experimental approaches are effective for studying ABRACL's role in cancer cell biology?

Several methodological approaches have proven effective for investigating ABRACL's functions in cancer contexts:

• RNA interference: ShRNA-mediated knockdown of ABRACL in cancer cell lines (e.g., MCF-7) allows for assessment of its role in proliferation, migration, and invasion. Two validated shRNA sequences have demonstrated effectiveness: shRNA-ABRACL-1 (5'-GCTGATGGAAAGTTAAGCGTG-3') and shRNA-ABRACL-2 (5'-GCCAACCTCTTTGAAGCATTG-3') .

• Proliferation assays: Following ABRACL knockdown, researchers can employ:

  • CCK-8 assays: Plating 5×10³ cells/well in 96-well plates, measuring absorbance at 24, 48, and 72 hours

  • Colony formation assays: Plating 1×10³ cells/well in 6-well plates for 14 days, followed by fixation with 4% formaldehyde and staining with 0.5% crystal violet

• Migration and invasion assessment:

  • Transwell assays: Using 5×10⁴ cells per well suspended in serum-free medium added to transwell chambers coated with 10% Matrigel, with FBS-containing medium in the lower chamber

  • Wound healing assays: Creating a standardized "wound" in a confluent monolayer and measuring closure rates

• EMT marker analysis: Western blot analysis of epithelial-mesenchymal transition markers (E-cadherin, N-cadherin, Vimentin, Snail) following ABRACL manipulation to understand its impact on cancer cell phenotype switching .

• Transcriptional regulation studies: Chromatin immunoprecipitation (ChIP) and luciferase reporter assays to investigate the relationship between transcription factors (e.g., MYBL2) and ABRACL regulation in cancer cells .

How should researchers design immunofluorescence experiments to investigate ABRACL expression in neural tissues?

Designing effective immunofluorescence experiments for ABRACL in neural tissues requires careful consideration of several factors:

• Tissue preparation: For embryonic brain tissues, paraformaldehyde (PFA) fixation (4%, 24h) followed by cryoprotection in 30% sucrose and sectioning at 20μm thickness has been validated .

• Antigen retrieval: Heat-mediated antigen retrieval in sodium citrate buffer (pH 6.0) improves signal quality for many neural antigens, including ABRACL.

• Antibody selection and dilution: Anti-ABRACL antibodies (e.g., ATLAS Antibodies HPA030217) have been validated at 1:100 dilution for neural tissue immunofluorescence .

• Double-labeling strategy: ABRACL can be effectively co-labeled with:

  • Proliferation markers: Ki67 (1:500)

  • Progenitor cell markers: Ascl1, Dlx2 (1:100)

  • Post-mitotic neuron markers: Tubb3 (1:100), Gad65/67 (1:100), Lhx6 (1:100), Tbr1 (1:100)

• Imaging parameters: Confocal microscopy with z-stack acquisition enables detailed colocalization analysis. Standardize exposure settings between experimental and control samples.

• Developmental time points: For neural development studies, examining multiple embryonic stages (e.g., E11.5, E12.5, E13.5, E15.5, and E18.5 in mice) provides comprehensive understanding of dynamic expression patterns .

• Species considerations: While mouse models are common, cross-species validation (e.g., in feline embryos) has been successfully employed to confirm evolutionary conservation of expression patterns .

How can researchers investigate the relationship between ABRACL mRNA and protein expression patterns?

Investigating discrepancies between ABRACL mRNA and protein expression requires sophisticated methodological approaches:

• Combined ISH-IF approach: Sequential in situ hybridization (for mRNA) and immunofluorescence (for protein) on the same tissue sections allows direct comparison of expression domains. This approach revealed that ABRACL protein has a broader expression domain than its mRNA in developing brain tissue .

• Single-cell multi-omics: Integration of single-cell RNA sequencing with proteomics data provides cell-type-specific correlation between transcript and protein levels. Previous studies have utilized scRNA-seq of E12.5 and E14.5 embryonic mouse forebrains to map ABRACL mRNA expression .

• Temporal expression analysis: Time-course experiments comparing mRNA and protein expression can reveal post-transcriptional regulatory mechanisms and protein stability differences. For ABRACL, significant differences have been observed in late embryonic developmental stages where protein expression persists in regions where mRNA is no longer detected .

• Subcellular fractionation: Differential extraction of nuclear, cytoplasmic, and membrane-associated fractions followed by Western blot analysis can identify protein localization patterns that may differ from mRNA distribution.

• Translation efficiency assessment: Polysome profiling combined with mRNA quantification can determine whether translational control contributes to differences between mRNA and protein abundance.

• Degradation rate studies: Pulse-chase experiments using protein synthesis inhibitors can determine if extended protein half-life contributes to broader protein detection compared to mRNA.

What approaches are effective for studying ABRACL's interaction with the actin cytoskeleton?

To investigate ABRACL's involvement in actin dynamics, researchers can employ several specialized techniques:

• Co-immunoprecipitation (Co-IP): Pull-down assays using anti-ABRACL antibodies followed by Western blot for actin-related proteins can identify physical interactions. This approach can be enhanced by using crosslinking agents to stabilize transient interactions.

• Proximity ligation assay (PLA): This technique enables visualization of protein-protein interactions within 40nm distance in fixed cells, allowing spatial mapping of ABRACL-actin interactions in different cellular compartments.

• Live cell imaging: Expressing fluorescently-tagged ABRACL (ensuring tag position doesn't interfere with function) together with actin markers enables real-time visualization of dynamic interactions during processes like cell migration.

• Actin polymerization assays: In vitro pyrene-actin polymerization assays with purified ABRACL can determine direct effects on actin filament assembly or disassembly rates.

• Rho GTPase activity assays: Since ABRACL shares similarity with Rho-activating proteins, FRET-based biosensors for Rho GTPases can monitor their activation in response to ABRACL manipulation.

• Cytoskeletal fractionation: Separation of G-actin and F-actin pools followed by Western blot analysis can determine if ABRACL manipulation alters the G/F-actin ratio, indicating effects on polymerization dynamics.

• Traction force microscopy: This approach measures cellular forces generated through the actin cytoskeleton, providing functional readouts of how ABRACL affects actin-dependent mechanical processes.

How should researchers interpret conflicting results between ABRACL studies in different cell types?

Conflicting findings regarding ABRACL function across different experimental systems require careful interpretation:

• Cell-type specificity: ABRACL may have context-dependent functions. For example, while it promotes proliferation in cancer cells , its expression in post-mitotic neurons suggests different roles in differentiated cells . Researchers should explicitly acknowledge this context-dependence rather than attempting to force a unified model.

• Isoform expression: Verify whether different cell types express distinct ABRACL isoforms that may have varying functions. RT-PCR with isoform-specific primers followed by sequencing can resolve this question.

• Interaction partners: ABRACL's function may depend on the presence of specific binding partners that vary between cell types. Proximity-based biotinylation (BioID) or interactome profiling in different cellular contexts can identify cell-type-specific interaction networks.

• Quantitative differences: Absolute quantification of ABRACL levels using techniques like selected reaction monitoring (SRM) mass spectrometry can determine if conflicting results stem from expression level differences rather than functional divergence.

• Redundancy mechanisms: Some cell types may have redundant mechanisms that compensate for ABRACL manipulation. Combined knockdown of ABRACL along with related proteins can reveal synergistic effects masked by redundancy.

• Post-translational modifications: Cell-type-specific PTMs may alter ABRACL function. Phosphoproteomic analysis following immunoprecipitation can identify regulatory modifications that differ between experimental systems.

What are the essential controls for validating findings from ABRACL antibody-based experiments?

• Genetic controls:

  • Knockout/knockdown validation: Demonstrate antibody signal reduction in ABRACL knockdown samples using validated shRNAs (e.g., 5'-GCTGATGGAAAGTTAAGCGTG-3')

  • Overexpression validation: Show increased signal in ABRACL-overexpressing samples

• Antibody controls:

  • Isotype controls: Use matched IgG at equivalent concentrations

  • Absorption controls: Pre-incubate antibody with immunizing peptide to block specific binding

  • Secondary-only controls: Omit primary antibody to assess non-specific secondary binding

• Technical controls:

  • Multiple antibodies: Validate key findings with independent antibodies targeting different ABRACL epitopes

  • Multiple detection methods: Confirm results using alternative techniques (e.g., validate IF findings with Western blot)

  • Biological replicates: Demonstrate reproducibility across independent experiments and biological samples

• Quantification controls:

  • Blinded analysis: Perform quantification without knowledge of sample identity

  • Standardized normalization: Use consistent reference proteins or housekeeping genes

  • Statistical validation: Apply appropriate statistical tests based on data distribution

• Functional validation:

  • Rescue experiments: Reverse phenotypes by reintroducing ABRACL in knockdown backgrounds

  • Dose-response relationships: Demonstrate correlation between ABRACL levels and observed effects

Implementing these controls systematically increases confidence in ABRACL-related findings and facilitates comparison across different experimental systems and research groups.

How can ABRACL antibodies be used to investigate neuronal migration and axon development?

ABRACL's detection in migrating interneurons and major telencephalic fiber tracts suggests important roles in neural development . Researchers can investigate these functions through:

• Live imaging approaches: Ex vivo brain slice cultures from transgenic mice expressing fluorescent proteins in specific neuronal populations, combined with immunofluorescence for ABRACL, can track migration patterns and correlate ABRACL expression with migratory behavior.

• Primary neuronal cultures: Dissociated neuronal cultures from developing brain regions (e.g., E13.5 pallium and subpallium) enable detailed analysis of ABRACL localization during neurite extension and axon specification .

• Growth cone isolation: Subcellular fractionation to isolate growth cone particles followed by Western blot analysis can determine if ABRACL is enriched in these specialized structures that guide axon pathfinding.

• Conditional knockdown approaches: Region-specific or cell-type-specific ABRACL manipulation using Cre-loxP systems allows investigation of autonomous versus non-autonomous effects on neuronal migration and axon development.

• High-resolution imaging: Super-resolution microscopy techniques (STED, STORM) can reveal the precise subcellular localization of ABRACL in relation to cytoskeletal elements during different stages of neuronal migration and axon extension.

• Explant assays: Testing how manipulation of ABRACL levels affects the migration of neurons from explanted brain regions in controlled in vitro environments with specific guidance cues.

These approaches can provide mechanistic insights into ABRACL's role in the complex developmental processes that establish neural circuits.

What are the most promising directions for investigating ABRACL's role in cancer progression?

Several promising research directions emerge from current understanding of ABRACL in cancer:

• Metastasis models: Given ABRACL's role in migration and invasion , mouse models of metastatic spread with ABRACL manipulation would provide in vivo validation of its contribution to cancer progression.

• ABRACL as a biomarker: Analysis of ABRACL expression across patient cohorts using tissue microarrays and correlation with clinical outcomes could establish its potential as a prognostic marker.

• Therapeutic targeting: Structure-based drug design targeting the ABRACL protein or screening for small-molecule inhibitors of its interaction with actin-regulatory proteins might yield novel therapeutic approaches.

• Transcriptional regulation network: Expanding on the MYBL2-ABRACL axis , exploration of the complete transcriptional control network governing ABRACL expression in different cancer types could reveal upstream regulatory mechanisms.

• Pathway integration: Investigation of how ABRACL connects to established cancer signaling pathways through techniques like proximity labeling, phosphoproteomics, and genetic epistasis experiments.

• Resistance mechanisms: Determining whether ABRACL upregulation contributes to therapy resistance by promoting survival or migration capacity in cancer cells exposed to conventional treatments.

These directions could establish ABRACL not only as a cancer biomarker but potentially as a therapeutic target in specific cancer contexts.