ADCK4 Antibody

What is ADCK4 and why is it significant in research?

ADCK4 (aarF domain containing kinase 4) is a protein kinase that plays a critical role in coenzyme Q10 (CoQ10) biosynthesis and mitochondrial function. Its significance stems from its association with steroid-resistant nephrotic syndrome and CoQ10 deficiency . ADCK4, also known as COQ8B, is essential for proper podocyte function in the kidneys. The calculated molecular weight of human ADCK4 is approximately 60 kDa, consisting of 544 amino acids . Research interest in ADCK4 has increased due to findings that mutations in this gene can lead to focal segmental glomerulosclerosis (FSGS) with significant clinical implications .

What species reactivity do commercial ADCK4 antibodies demonstrate?

Commercial ADCK4 antibodies typically show reactivity across multiple mammalian species. Based on the available data, polyclonal antibodies against ADCK4 demonstrate confirmed reactivity with human, mouse, and rat samples . This cross-species reactivity makes these antibodies valuable for comparative studies across different model organisms. When selecting an antibody for your research, it's important to verify the specific reactivity pattern of your chosen antibody, as this may vary between commercial sources.

What are the common applications for ADCK4 antibodies in research?

ADCK4 antibodies are utilized in several key experimental techniques:

These applications enable researchers to investigate ADCK4 expression patterns, subcellular localization, and potential changes in expression under various experimental conditions . When designing experiments, it's advisable to optimize antibody concentrations for your specific experimental system and tissue type.

How should ADCK4 antibodies be stored and handled for optimal performance?

For short-term storage, ADCK4 antibodies should be kept at 4°C. For long-term storage, aliquoting and storing at -20°C is recommended to maintain antibody integrity and performance . It's crucial to avoid repeated freeze-thaw cycles as these can degrade the antibody and reduce its effectiveness. Most commercial ADCK4 antibodies are supplied in a storage buffer containing PBS (pH 7.2) with 40% glycerol and 0.02% sodium azide , or PBS with 0.02% sodium azide and 50% glycerol (pH 7.3) . These components help maintain antibody stability and prevent microbial contamination.

How can I validate the specificity of ADCK4 antibodies for my experimental system?

Validating antibody specificity is critical for ensuring reliable results. A comprehensive validation approach should include:

• Positive and negative controls: Use tissues or cell lines known to express or lack ADCK4.

• Knockdown/knockout verification: Compare antibody reactivity in wild-type versus ADCK4 knockout or knockdown samples. Studies with ADCK4-knockout podocytes demonstrate the utility of this approach .

• Peptide competition assay: Pre-incubate the antibody with the immunizing peptide (if available) to confirm that this blocks specific binding.

• Cross-validation with multiple antibodies: Use antibodies raised against different epitopes of ADCK4.

• Protein array verification: Some commercial antibodies have been validated on protein arrays containing the target protein plus hundreds of non-specific proteins to ensure specificity .

For ADCK4 specifically, validation using recombinant protein corresponding to the amino acid sequence RQSADFMPRWQMLRVLEEELGRDWQAKVASLEEVPFAAASIGQVHQGLLRDGTEVAVKIQY has been reported .

What experimental approaches can be used to study ADCK4 function in mitochondrial biology?

ADCK4's role in mitochondrial function can be investigated through several complementary approaches:

• Respiratory chain activity measurement: ADCK4 knockout has been shown to significantly reduce respiratory chain activity, reflecting its importance in mitochondrial function .

• CoQ10 level quantification: ADCK4-deficient cells exhibit reduced CoQ10 levels, which can be measured to assess ADCK4 function .

• Mitochondrial potential assessment: Fluorescent dyes that measure mitochondrial membrane potential can reveal functional consequences of ADCK4 deficiency .

• Electron microscopy: This technique can visualize mitochondrial morphology changes associated with ADCK4 deficiency, such as dysmorphic mitochondria with loss of cristae formation .

• Protein-protein interaction studies: ADCK4 interacts with mitochondrial proteins including COQ5, and these interactions can be studied using co-immunoprecipitation or proximity labeling techniques .

• Rescue experiments: Treatment with CoQ10 precursor analogs, such as 2,4-dihydroxybenzoic acid (2,4-diHB), can rescue phenotypes associated with ADCK4 deficiency, providing insights into ADCK4 function .

How can I investigate ADCK4-associated pathology in kidney disease models?

To investigate ADCK4's role in kidney disease, researchers have employed several approaches:

• Podocyte-specific knockout models: Generating podocyte-specific Adck4-knockout mice has been valuable for studying ADCK4-associated glomerulopathy .

• Histopathological analysis: ADCK4 deficiency in mouse models leads to focal segmental glomerulosclerosis (FSGS) with extensive interstitial fibrosis and tubular atrophy .

• Urinary CoQ10 measurement: The ratio of urinary CoQ10 to creatinine has been proposed as a potential diagnostic biomarker for ADCK4-associated glomerulopathy . In one case study, this ratio was nearly 5 times higher in a patient with ADCK4-associated glomerulopathy compared to healthy controls .

• Therapeutic intervention studies: CoQ10 supplementation or treatment with 2,4-diHB has been shown to prevent development of renal dysfunction in ADCK4-deficient models . Monitoring proteinuria changes during treatment can provide insights into disease mechanisms.

• Cell culture models: ADCK4-knockout podocyte cell lines provide a system for investigating cellular mechanisms in a controlled environment .

What controls should I include when using ADCK4 antibodies for immunohistochemistry?

Robust controls are essential for reliable immunohistochemistry results with ADCK4 antibodies:

• Positive tissue control: Include kidney tissue, particularly from podocytes where ADCK4 is highly expressed .

• Negative tissue control: Use tissues known not to express ADCK4 or sections from ADCK4 knockout animals.

• Primary antibody omission: Process some sections without the primary antibody to assess background staining.

• Isotype control: Include a non-specific antibody of the same isotype (e.g., Rabbit IgG for ADCK4 polyclonal antibodies ) to evaluate non-specific binding.

• Peptide competition: Pre-incubate the antibody with the immunizing peptide to confirm staining specificity.

• Concentration controls: Test multiple antibody dilutions (1:500 - 1:1000 is recommended for ADCK4 antibodies in paraffin-embedded tissues ) to optimize signal-to-noise ratio.

• Sample preparation controls: Verify that your fixation and antigen retrieval protocols are optimized for ADCK4 detection.

How can I optimize Western blot conditions for detecting ADCK4 protein?

Optimizing Western blot conditions for ADCK4 detection requires attention to several parameters:

• Sample preparation: For mitochondrial proteins like ADCK4, consider using specific extraction buffers that preserve mitochondrial proteins.

• Protein loading: Load sufficient protein (typically 20-50 μg of total protein) to detect ADCK4, which has a calculated molecular weight of approximately 60 kDa .

• Gel percentage: Use 10-12% polyacrylamide gels for optimal resolution of ADCK4.

• Transfer conditions: Optimize transfer time and voltage; for proteins in the 60 kDa range, standard semi-dry or wet transfer protocols are typically effective.

• Blocking conditions: 5% non-fat dry milk or BSA in TBST is generally effective, but optimization may be necessary.

• Antibody concentration: Start with the recommended concentration (0.4 μg/ml for Western blot ) and adjust as needed.

• Incubation conditions: Primary antibody incubation at 4°C overnight often yields optimal results, but this may vary.

• Detection method: Choose appropriate secondary antibodies and detection reagents based on your expected signal strength.

• Positive control: Include a lysate from cells known to express ADCK4 (human, mouse, or rat tissue lysates have been validated ).

What are common causes of false positive or negative results when using ADCK4 antibodies?

Several factors can lead to misleading results when working with ADCK4 antibodies:

False Positives:

• Cross-reactivity with related proteins, particularly other ADCK family members

• Excessive antibody concentration leading to non-specific binding

• Inadequate blocking leading to high background

• Contamination of secondary antibody

• Overly sensitive detection systems amplifying non-specific signals

False Negatives:

• Insufficient antigen due to low ADCK4 expression or poor protein extraction

• Epitope masking due to protein folding or post-translational modifications

• Degradation of ADCK4 during sample preparation

• Antibody deterioration due to improper storage or handling

• Inadequate antigen retrieval for fixed tissues

• Incompatibility between the epitope recognized by the antibody and the species being studied

To minimize these issues, validate antibodies using multiple techniques, optimize experimental conditions, and include appropriate controls in each experiment.

How should I interpret ADCK4 antibody staining patterns in relation to mitochondrial localization?

ADCK4 is primarily localized to mitochondria, where it functions in CoQ10 biosynthesis . When interpreting immunostaining results:

• Expected pattern: ADCK4 staining should show a punctate cytoplasmic pattern consistent with mitochondrial localization.

• Co-localization studies: Consider dual staining with established mitochondrial markers to confirm proper localization.

• Subcellular fractionation: Western blot analysis of mitochondrial fractions can complement immunostaining data.

• Cell type variation: ADCK4 expression may vary between cell types, with particularly high expression in podocytes .

• Pathological changes: In disease states, altered ADCK4 staining patterns may reflect mitochondrial dysfunction or altered protein expression.

• Quantitative assessment: Changes in staining intensity should be quantified using appropriate imaging software and statistical analysis.

Research has shown that ADCK4 interacts with mitochondrial proteins such as COQ5 , so co-localization with these proteins can provide additional evidence for specific staining.

How can ADCK4 antibodies be used to study potential therapeutic approaches for ADCK4-associated diseases?

ADCK4 antibodies can facilitate research into therapeutic approaches for ADCK4-associated diseases in several ways:

• Monitoring protein expression: Western blotting with ADCK4 antibodies can verify the effectiveness of gene therapy approaches aimed at restoring ADCK4 expression.

• Evaluating drug effects: Immunohistochemistry can assess whether therapeutic compounds restore normal ADCK4 localization or expression in affected tissues.

• Biomarker development: ADCK4 antibodies may help develop assays to monitor disease progression or treatment response, complementing other biomarkers such as the urinary CoQ10 to creatinine ratio .

• Target validation: Antibodies can confirm the presence of ADCK4 in target tissues for drug development.

• Mechanistic studies: Investigating ADCK4 interactions with other proteins may reveal additional therapeutic targets.

Research has shown that treatment with CoQ10 or its precursor analogs can rescue phenotypes associated with ADCK4 deficiency . ADCK4 antibodies can help monitor these effects at the molecular level, providing mechanistic insights into therapeutic responses.

What are the latest advances in understanding ADCK4's role in the coenzyme Q complex?

Recent research has revealed important insights into ADCK4's role in the coenzyme Q complex:

• Complex stability: ADCK4 deficiency destabilizes the coenzyme Q complex, leading to reduced CoQ10 biosynthesis .

• Protein interactions: ADCK4 interacts with mitochondrial proteins including COQ5, suggesting a role in organizing or stabilizing the CoQ biosynthetic complex .

• Rescue mechanisms: ADCK4 knockout decreases COQ complex levels, but this can be rescued by ADCK4 overexpression .

• Therapeutic implications: The finding that 2,4-dihydroxybenzoic acid (2,4-diHB), an analog of CoQ10 precursor molecules, can rescue phenotypes associated with ADCK4 deficiency suggests that bypass approaches to CoQ10 biosynthesis may be therapeutically useful .

• Biomarker potential: Elevated urinary CoQ10 levels in ADCK4-associated glomerulopathy may reflect altered CoQ10 metabolism and could serve as a diagnostic biomarker .

These findings highlight the central role of ADCK4 in maintaining the integrity and function of the CoQ biosynthetic machinery, with important implications for understanding and treating ADCK4-associated diseases.