ADCK4 antibodies are immunological reagents specifically designed to bind to the ADCK4 protein (also known as COQ8B). These antibodies are invaluable tools for detecting, quantifying, and studying the ADCK4 protein in various biological samples and experimental settings. Currently, several manufacturers offer ADCK4 antibodies with different properties, specifications, and applications, making them versatile research tools for investigating ADCK4's role in normal physiology and disease states .
ADCK4 antibodies are primarily used in laboratory research to elucidate the function, expression patterns, and pathological alterations of the ADCK4 protein. The importance of these antibodies has grown considerably with the increasing recognition of ADCK4's role in coenzyme Q10 biosynthesis and its implications in certain kidney diseases, particularly steroid-resistant nephrotic syndrome .
Proteintech offers a rabbit polyclonal ADCK4 antibody (catalog number 17104-1-AP) with the following specifications:
| Specification | Details |
|---|---|
| Host/Isotype | Rabbit/IgG |
| Tested Reactivity | Human, Mouse, Rat |
| Applications | ELISA |
| Immunogen | ADCK4 fusion protein Ag10776 |
| Calculated Molecular Weight | 544 aa, 60 kDa |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol pH 7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment |
This antibody is derived from rabbit immunization with a specific ADCK4 fusion protein and has undergone affinity purification to ensure specificity .
Another rabbit polyclonal antibody is available from Novus Biologicals (catalog number NBP1-85508):
| Specification | Details |
|---|---|
| Host/Isotype | Rabbit/IgG |
| Reactivity | Human, Mouse, Rat |
| Applications | Western Blot (0.4 μg/ml), Immunohistochemistry (1:500-1:1000), Immunohistochemistry-Paraffin (1:500-1:1000) |
| Immunogen | Recombinant protein corresponding to amino acids: RQSADFMPRWQMLRVLEEELGRDWQAKVASLEEVPFAAASIGQVHQGLLRDGTEVAVKIQY |
| Purification | Affinity Purified |
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Storage Conditions | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles |
This antibody has been specifically validated for Western Blot and immunohistochemistry applications, with established working dilutions for optimal results .
Proteintech also offers a mouse monoclonal ADCK4 antibody (catalog number 68877-1-Ig):
| Specification | Details |
|---|---|
| Host/Isotype | Mouse/IgG1 |
| Tested Reactivity | Human |
| Applications | Western Blot, ELISA |
| Immunogen | ADCK4 fusion protein Ag13188 |
| Observed Molecular Weight | 60 kDa |
| Purification Method | Protein G purification |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol pH 7.3 |
| Positive WB Detection | LNCaP cells, MCF-7 cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells |
| Recommended Dilution for WB | 1:5000-1:50000 |
Unlike the polyclonal antibodies, this monoclonal variant has been extensively validated in Western Blot applications with specific human cell lines and offers high specificity with recommended dilution ranges .
ADCK4 antibodies have been validated for several experimental applications, allowing researchers to study this protein in different contexts.
Western Blot represents one of the primary applications for ADCK4 antibodies, particularly the mouse monoclonal (68877-1-Ig) and Novus Biologicals (NBP1-85508) variants. The mouse monoclonal antibody has demonstrated effectiveness across multiple human cell lines including LNCaP, MCF-7, HeLa, HEK-293, HepG2, and Jurkat cells at dilutions ranging from 1:5000 to 1:50000 . This extensive validation across diverse cell types provides researchers with confidence when detecting ADCK4 in human samples.
The Novus Biologicals antibody (NBP1-85508) has been specifically validated for immunohistochemistry applications in both fresh tissue and paraffin-embedded samples at recommended dilutions of 1:500 to 1:1000 . This application enables researchers to visualize the spatial distribution of ADCK4 within tissue sections, providing insights into its localization in different cell types and subcellular compartments.
All three antibody variants described have demonstrated utility in ELISA applications, allowing for quantitative analysis of ADCK4 protein levels in various biological samples . This application is particularly valuable for high-throughput screening and quantitative comparative studies.
Understanding the ADCK4 protein is essential for appreciating the significance and applications of ADCK4 antibodies in research.
ADCK4 plays a critical role in the biosynthesis of coenzyme Q10 (CoQ10), an essential lipid-soluble electron transporter for aerobic cellular respiration. Recent research has revealed that ADCK4 is particularly important for maintaining the stability of the CoQ complex, which is crucial for CoQ10 biosynthesis .
In podocytes (specialized cells in the kidney's glomerular filter), ADCK4 is essential for maintaining mitochondrial function and cellular health. Research has shown that ADCK4 interacts with several mitochondrial proteins, including COQ5, and also with cytoplasmic proteins such as myosin and heat shock proteins .
Recent studies using ADCK4 antibodies have significantly advanced our understanding of this protein's role in health and disease.
Mutations in the ADCK4 gene have been associated with steroid-resistant nephrotic syndrome, a kidney condition characterized by proteinuria, hypoalbuminemia, and edema that does not respond to steroid treatment. Research using ADCK4 antibodies has helped elucidate the molecular mechanisms underlying this condition .
A landmark study demonstrated that ADCK4 deficiency leads to CoQ10 deficiency in podocytes, which subsequently causes mitochondrial dysfunction. This dysfunction ultimately results in podocyte injury and focal segmental glomerulosclerosis (FSGS), a common cause of nephrotic syndrome .
Researchers have developed a podocyte-specific Adck4-knockout mouse model to study the effects of ADCK4 deficiency. These studies, which utilized ADCK4 antibodies for validation and characterization, revealed several critical findings:
Podocyte-specific deletion of Adck4 in mice significantly reduced survival and caused severe FSGS with extensive interstitial fibrosis and tubular atrophy .
ADCK4-knockout mice developed albuminuria by 5 months of age, with a significant increase in albumin/creatinine ratio (up to 31.2-fold compared to control mice) .
ADCK4-knockout podocytes exhibited significantly decreased CoQ10 levels, reduced respiratory chain activity, decreased mitochondrial potential, and dysmorphic mitochondria with loss of cristae formation .
The kidney phenotype in these mice recapitulated features of human nephrotic syndrome caused by ADCK4 mutations, making this model valuable for studying the disease mechanisms and potential therapies .
Perhaps most significantly, research using these mouse models has identified a potential therapeutic approach for ADCK4-associated nephrotic syndrome. Treatment with 2,4-dihydroxybenzoic acid (2,4-diHB), an analog of a CoQ10 precursor molecule, prevented disease onset and progression in the ADCK4-knockout mice .
Specifically, when administered to 3-month-old mice (before disease onset), 2,4-diHB treatment:
Prevented the development of renal dysfunction
Normalized survival rates despite persistent proteinuria
Preserved normal glomerular histology
Significantly reduced the rate of sclerotic glomeruli
Improved expression of slit diaphragm proteins such as podocin and nephrin
Maintained normal podocyte morphology at the ultrastructural level
These findings suggest that supplementation with CoQ10 precursors might be a viable treatment strategy for patients with nephrotic syndrome resulting from ADCK4 mutations .
ADCK4 antibodies have significant clinical and research relevance beyond their experimental applications.
While currently primarily used in research settings, ADCK4 antibodies hold potential for developing diagnostic tools for ADCK4-associated disorders. The ability to detect altered ADCK4 expression or localization could complement genetic testing for ADCK4 mutations in patients with suspected steroid-resistant nephrotic syndrome .
In research laboratories, ADCK4 antibodies continue to play a crucial role in:
Investigating the molecular mechanisms of CoQ10 biosynthesis
Studying mitochondrial function in various cell types
Exploring the pathophysiology of ADCK4-associated kidney diseases
Evaluating potential therapeutic interventions for CoQ10 deficiency syndromes
Examining the role of ADCK4 in other organ systems beyond the kidney
ADCK4 (aarF domain containing kinase 4) is a protein kinase that plays a critical role in coenzyme Q10 (CoQ10) biosynthesis and mitochondrial function. Its significance stems from its association with steroid-resistant nephrotic syndrome and CoQ10 deficiency . ADCK4, also known as COQ8B, is essential for proper podocyte function in the kidneys. The calculated molecular weight of human ADCK4 is approximately 60 kDa, consisting of 544 amino acids . Research interest in ADCK4 has increased due to findings that mutations in this gene can lead to focal segmental glomerulosclerosis (FSGS) with significant clinical implications .
Commercial ADCK4 antibodies typically show reactivity across multiple mammalian species. Based on the available data, polyclonal antibodies against ADCK4 demonstrate confirmed reactivity with human, mouse, and rat samples . This cross-species reactivity makes these antibodies valuable for comparative studies across different model organisms. When selecting an antibody for your research, it's important to verify the specific reactivity pattern of your chosen antibody, as this may vary between commercial sources.
ADCK4 antibodies are utilized in several key experimental techniques:
These applications enable researchers to investigate ADCK4 expression patterns, subcellular localization, and potential changes in expression under various experimental conditions . When designing experiments, it's advisable to optimize antibody concentrations for your specific experimental system and tissue type.
For short-term storage, ADCK4 antibodies should be kept at 4°C. For long-term storage, aliquoting and storing at -20°C is recommended to maintain antibody integrity and performance . It's crucial to avoid repeated freeze-thaw cycles as these can degrade the antibody and reduce its effectiveness. Most commercial ADCK4 antibodies are supplied in a storage buffer containing PBS (pH 7.2) with 40% glycerol and 0.02% sodium azide , or PBS with 0.02% sodium azide and 50% glycerol (pH 7.3) . These components help maintain antibody stability and prevent microbial contamination.
Validating antibody specificity is critical for ensuring reliable results. A comprehensive validation approach should include:
Positive and negative controls: Use tissues or cell lines known to express or lack ADCK4.
Knockdown/knockout verification: Compare antibody reactivity in wild-type versus ADCK4 knockout or knockdown samples. Studies with ADCK4-knockout podocytes demonstrate the utility of this approach .
Peptide competition assay: Pre-incubate the antibody with the immunizing peptide (if available) to confirm that this blocks specific binding.
Cross-validation with multiple antibodies: Use antibodies raised against different epitopes of ADCK4.
Protein array verification: Some commercial antibodies have been validated on protein arrays containing the target protein plus hundreds of non-specific proteins to ensure specificity .
For ADCK4 specifically, validation using recombinant protein corresponding to the amino acid sequence RQSADFMPRWQMLRVLEEELGRDWQAKVASLEEVPFAAASIGQVHQGLLRDGTEVAVKIQY has been reported .
ADCK4's role in mitochondrial function can be investigated through several complementary approaches:
Respiratory chain activity measurement: ADCK4 knockout has been shown to significantly reduce respiratory chain activity, reflecting its importance in mitochondrial function .
CoQ10 level quantification: ADCK4-deficient cells exhibit reduced CoQ10 levels, which can be measured to assess ADCK4 function .
Mitochondrial potential assessment: Fluorescent dyes that measure mitochondrial membrane potential can reveal functional consequences of ADCK4 deficiency .
Electron microscopy: This technique can visualize mitochondrial morphology changes associated with ADCK4 deficiency, such as dysmorphic mitochondria with loss of cristae formation .
Protein-protein interaction studies: ADCK4 interacts with mitochondrial proteins including COQ5, and these interactions can be studied using co-immunoprecipitation or proximity labeling techniques .
Rescue experiments: Treatment with CoQ10 precursor analogs, such as 2,4-dihydroxybenzoic acid (2,4-diHB), can rescue phenotypes associated with ADCK4 deficiency, providing insights into ADCK4 function .
To investigate ADCK4's role in kidney disease, researchers have employed several approaches:
Podocyte-specific knockout models: Generating podocyte-specific Adck4-knockout mice has been valuable for studying ADCK4-associated glomerulopathy .
Histopathological analysis: ADCK4 deficiency in mouse models leads to focal segmental glomerulosclerosis (FSGS) with extensive interstitial fibrosis and tubular atrophy .
Urinary CoQ10 measurement: The ratio of urinary CoQ10 to creatinine has been proposed as a potential diagnostic biomarker for ADCK4-associated glomerulopathy . In one case study, this ratio was nearly 5 times higher in a patient with ADCK4-associated glomerulopathy compared to healthy controls .
Therapeutic intervention studies: CoQ10 supplementation or treatment with 2,4-diHB has been shown to prevent development of renal dysfunction in ADCK4-deficient models . Monitoring proteinuria changes during treatment can provide insights into disease mechanisms.
Cell culture models: ADCK4-knockout podocyte cell lines provide a system for investigating cellular mechanisms in a controlled environment .
Robust controls are essential for reliable immunohistochemistry results with ADCK4 antibodies:
Positive tissue control: Include kidney tissue, particularly from podocytes where ADCK4 is highly expressed .
Negative tissue control: Use tissues known not to express ADCK4 or sections from ADCK4 knockout animals.
Primary antibody omission: Process some sections without the primary antibody to assess background staining.
Isotype control: Include a non-specific antibody of the same isotype (e.g., Rabbit IgG for ADCK4 polyclonal antibodies ) to evaluate non-specific binding.
Peptide competition: Pre-incubate the antibody with the immunizing peptide to confirm staining specificity.
Concentration controls: Test multiple antibody dilutions (1:500 - 1:1000 is recommended for ADCK4 antibodies in paraffin-embedded tissues ) to optimize signal-to-noise ratio.
Sample preparation controls: Verify that your fixation and antigen retrieval protocols are optimized for ADCK4 detection.
Optimizing Western blot conditions for ADCK4 detection requires attention to several parameters:
Sample preparation: For mitochondrial proteins like ADCK4, consider using specific extraction buffers that preserve mitochondrial proteins.
Protein loading: Load sufficient protein (typically 20-50 μg of total protein) to detect ADCK4, which has a calculated molecular weight of approximately 60 kDa .
Gel percentage: Use 10-12% polyacrylamide gels for optimal resolution of ADCK4.
Transfer conditions: Optimize transfer time and voltage; for proteins in the 60 kDa range, standard semi-dry or wet transfer protocols are typically effective.
Blocking conditions: 5% non-fat dry milk or BSA in TBST is generally effective, but optimization may be necessary.
Antibody concentration: Start with the recommended concentration (0.4 μg/ml for Western blot ) and adjust as needed.
Incubation conditions: Primary antibody incubation at 4°C overnight often yields optimal results, but this may vary.
Detection method: Choose appropriate secondary antibodies and detection reagents based on your expected signal strength.
Positive control: Include a lysate from cells known to express ADCK4 (human, mouse, or rat tissue lysates have been validated ).
Several factors can lead to misleading results when working with ADCK4 antibodies:
False Positives:
Cross-reactivity with related proteins, particularly other ADCK family members
Excessive antibody concentration leading to non-specific binding
Inadequate blocking leading to high background
Contamination of secondary antibody
Overly sensitive detection systems amplifying non-specific signals
False Negatives:
Insufficient antigen due to low ADCK4 expression or poor protein extraction
Epitope masking due to protein folding or post-translational modifications
Degradation of ADCK4 during sample preparation
Antibody deterioration due to improper storage or handling
Inadequate antigen retrieval for fixed tissues
Incompatibility between the epitope recognized by the antibody and the species being studied
To minimize these issues, validate antibodies using multiple techniques, optimize experimental conditions, and include appropriate controls in each experiment.
ADCK4 is primarily localized to mitochondria, where it functions in CoQ10 biosynthesis . When interpreting immunostaining results:
Expected pattern: ADCK4 staining should show a punctate cytoplasmic pattern consistent with mitochondrial localization.
Co-localization studies: Consider dual staining with established mitochondrial markers to confirm proper localization.
Subcellular fractionation: Western blot analysis of mitochondrial fractions can complement immunostaining data.
Cell type variation: ADCK4 expression may vary between cell types, with particularly high expression in podocytes .
Pathological changes: In disease states, altered ADCK4 staining patterns may reflect mitochondrial dysfunction or altered protein expression.
Quantitative assessment: Changes in staining intensity should be quantified using appropriate imaging software and statistical analysis.
Research has shown that ADCK4 interacts with mitochondrial proteins such as COQ5 , so co-localization with these proteins can provide additional evidence for specific staining.
ADCK4 antibodies can facilitate research into therapeutic approaches for ADCK4-associated diseases in several ways:
Monitoring protein expression: Western blotting with ADCK4 antibodies can verify the effectiveness of gene therapy approaches aimed at restoring ADCK4 expression.
Evaluating drug effects: Immunohistochemistry can assess whether therapeutic compounds restore normal ADCK4 localization or expression in affected tissues.
Biomarker development: ADCK4 antibodies may help develop assays to monitor disease progression or treatment response, complementing other biomarkers such as the urinary CoQ10 to creatinine ratio .
Target validation: Antibodies can confirm the presence of ADCK4 in target tissues for drug development.
Mechanistic studies: Investigating ADCK4 interactions with other proteins may reveal additional therapeutic targets.
Research has shown that treatment with CoQ10 or its precursor analogs can rescue phenotypes associated with ADCK4 deficiency . ADCK4 antibodies can help monitor these effects at the molecular level, providing mechanistic insights into therapeutic responses.
Recent research has revealed important insights into ADCK4's role in the coenzyme Q complex:
Complex stability: ADCK4 deficiency destabilizes the coenzyme Q complex, leading to reduced CoQ10 biosynthesis .
Protein interactions: ADCK4 interacts with mitochondrial proteins including COQ5, suggesting a role in organizing or stabilizing the CoQ biosynthetic complex .
Rescue mechanisms: ADCK4 knockout decreases COQ complex levels, but this can be rescued by ADCK4 overexpression .
Therapeutic implications: The finding that 2,4-dihydroxybenzoic acid (2,4-diHB), an analog of CoQ10 precursor molecules, can rescue phenotypes associated with ADCK4 deficiency suggests that bypass approaches to CoQ10 biosynthesis may be therapeutically useful .
Biomarker potential: Elevated urinary CoQ10 levels in ADCK4-associated glomerulopathy may reflect altered CoQ10 metabolism and could serve as a diagnostic biomarker .
These findings highlight the central role of ADCK4 in maintaining the integrity and function of the CoQ biosynthetic machinery, with important implications for understanding and treating ADCK4-associated diseases.