ADH6 Antibody

What is ADH6 and why is it significant in biomedical research?

ADH6 (Alcohol Dehydrogenase 6) is a class V alcohol dehydrogenase belonging to the alcohol dehydrogenase family. Its significance stems from its role in metabolizing diverse substrates, including ethanol, retinol, aliphatic alcohols, hydroxysteroids, and lipid peroxidation products . The gene contains a glucocorticoid response element upstream of its 5' UTR, indicating potential hormonal regulation . ADH6 is primarily expressed in the stomach and liver, with alternatively spliced transcript variants encoding different isoforms . Understanding ADH6 function has implications for alcohol metabolism research, cancer studies, and neuropsychiatric disorders, as common ADH variants have been associated with conditions like schizophrenia and autism in specific populations .

What are the optimal applications for ADH6 antibodies in experimental techniques?

ADH6 antibodies have been validated for multiple experimental techniques with varying optimal applications:

When designing experiments, it's critical to conduct antibody titration for each specific application and sample type to determine optimal working concentrations . Validation in your specific experimental model is recommended as reactivity can vary across species and tissue types.

How should ADH6 antibodies be stored to maintain optimal activity?

For maximal preservation of antibody activity, store ADH6 antibodies aliquoted at -20°C in the buffer provided by the manufacturer, typically PBS with 0.02-0.09% sodium azide and 50% glycerol at pH 7.3 . Avoid repeated freeze-thaw cycles as these significantly degrade antibody performance . Working aliquots can be stored at 4°C for short periods (usually one week), but long-term storage requires -20°C conditions . While some researchers recycle antibodies, this practice is generally not recommended as changes in buffer composition and variable storage conditions between uses can compromise performance . If recycling is necessary due to resource constraints, high-titer antibodies may be reused approximately three times when stored properly at 4°C between uses, though performance will gradually diminish .

What criteria should researchers use when selecting between monoclonal and polyclonal ADH6 antibodies?

The selection between monoclonal and polyclonal ADH6 antibodies should be based on experimental requirements:

Monoclonal ADH6 Antibodies:

• Offer high specificity against a single epitope with minimal batch-to-batch variation

• Examples include clone 4G4 (IgG2aκ) and WW32 (IgG2a kappa) that target human ADH6

• Optimal for applications requiring consistent long-term supply and high reproducibility

• May have lower sensitivity than polyclonal antibodies as they detect single epitopes

• Best suited for specific protein detection when background must be minimized

Polyclonal ADH6 Antibodies:

• Recognize multiple epitopes on the ADH6 protein, providing higher sensitivity

• Generated using various immunogens including KLH-conjugated synthetic peptides from the Central region (amino acids 209-240) of human ADH6

• Show broader species cross-reactivity (human, mouse, rat, rabbit)

• Exhibit greater batch-to-batch variation but offer enhanced signal amplification

• Advantageous for detecting denatured proteins or lower-abundance targets

The choice should align with specific experimental needs: use monoclonals when reproducibility and specificity are paramount, and polyclonals when maximum sensitivity and detection of potentially altered proteins is required.

How does the choice of immunogen affect ADH6 antibody performance?

The immunogen used for ADH6 antibody generation significantly impacts specificity, sensitivity, and cross-reactivity:

Different commercial ADH6 antibodies utilize distinct immunogens:

• KLH-conjugated synthetic peptides from the Central region (amino acids 209-240) of human ADH6

• Full ADH6 fusion proteins

• Specific sequences like "GSKHLDLLYPTILGHEGAGIVESIGEGVSTVKPGDKVITLFLPQCGECTSCLNSEGNFCIQFKQSKTQLMSDGTSRFTCKGKSIYHFGNT"

The immunogen selection dictates epitope recognition and influences:

• Species cross-reactivity: Antibodies raised against conserved regions show broader cross-reactivity across species. The amino acid sequence conservation between human and rodent ADH6 determines cross-species utility .

• Isoform detection: The full protein sequence of human ADH6 is 368 amino acids with alternatively spliced variants . Antibodies targeting conserved regions can detect multiple isoforms, while those targeting splice-variant-specific regions are isoform-selective.

• Detection in different applications: The native conformation of epitopes affects performance in different techniques. Linear epitope antibodies perform better in Western blot with denatured proteins, while conformational epitope antibodies excel in applications with native proteins like IP or IF .

When selecting an ADH6 antibody, researchers should evaluate not just the host and clonality, but specifically which region of ADH6 was used as the immunogen, ensuring alignment with experimental requirements and target species.

What validation methods confirm ADH6 antibody specificity and minimize false positives?

Comprehensive validation of ADH6 antibodies requires multiple approaches to ensure specificity:

• Positive and negative control tissues:

  • Confirm positive signal in tissues known to express ADH6 (liver and stomach)

  • Verify absence of signal in tissues with negligible ADH6 expression

  • For human samples, liver tissue serves as an excellent positive control

• Knockout/knockdown validation:

  • Test antibodies in ADH6-knockdown or knockout models

  • Compare with wild-type samples to confirm specificity

  • This represents the gold standard for antibody validation but limited data exists for ADH6

• Recombinant protein controls:

  • Use purified recombinant ADH6 protein as a positive control

  • Perform peptide competition assays to confirm epitope specificity

  • Block antibody with immunizing peptide to demonstrate signal specificity

• Cross-reactivity assessment:

  • Evaluate potential cross-reactivity with other ADH family members (ADH1-ADH5)

  • Human ADH6 shows approximately 60% positional identity with other human ADHs

  • Pay particular attention to cross-reactivity with ADH5, as it's sometimes listed as an alias for ADH6

• Multiple antibody comparison:

  • Use two or more antibodies targeting different epitopes of ADH6

  • Concordant results from different antibodies increase confidence in specificity

  • Compare monoclonal and polyclonal antibodies for consistent detection patterns

Implementation of these validation strategies significantly reduces the risk of false positives and increases confidence in experimental results using ADH6 antibodies.

How can researchers optimize Western blot protocols for ADH6 detection?

Optimizing Western blot protocols for ADH6 detection requires attention to several critical parameters:

• Sample preparation:

  • Extract proteins from tissues with high ADH6 expression (liver, stomach) as positive controls

  • Use RIPA or NP-40 buffers with protease inhibitors to prevent degradation

  • Include reducing agents (β-mercaptoethanol or DTT) to break disulfide bonds as ADH6 contains zinc-binding motifs

• Gel selection and protein loading:

  • Use 10-12% polyacrylamide gels for optimal resolution around 39-40 kDa (ADH6's expected molecular weight)

  • Load 20-50 μg of total protein for tissue lysates

  • Include molecular weight markers spanning 25-55 kDa range

• Transfer conditions:

  • Wet transfer at 100V for 1 hour or 30V overnight at 4°C for efficient transfer

  • Use PVDF membranes for better protein retention and higher sensitivity

  • Verify transfer efficiency with reversible protein stains before blocking

• Antibody incubation parameters:

  • Optimal primary antibody dilutions vary significantly (1:200-1:100,000)

  • Start with manufacturer's recommended dilution, then optimize

  • Incubate primary antibody overnight at 4°C for maximum sensitivity

  • Use 5% non-fat dry milk or BSA in TBST for blocking and antibody dilution

• Signal detection optimization:

  • For low abundance detection, use enhanced chemiluminescence (ECL) substrates

  • Consider fluorescent secondary antibodies for quantitative analysis

  • Adjust exposure times based on signal intensity to avoid saturation

• Troubleshooting strategies:

  • If detecting multiple bands, perform peptide competition assays to identify specific signal

  • If signal is weak, increase antibody concentration or protein loading

  • If background is high, extend blocking time or increase washing stringency

Following this optimized protocol significantly improves the likelihood of specific and sensitive ADH6 detection in Western blot applications.

What approaches can resolve discrepancies in ADH6 detection across different species?

Resolving cross-species detection discrepancies for ADH6 requires systematic analysis and optimization:

• Sequence homology analysis:

  • Human ADH6 (UniProt ID: P28332) shares varying degrees of homology with mouse (69117), rat (295498, 310903), and other species

  • Analyze sequence conservation in the epitope region recognized by the antibody

  • Predict cross-reactivity based on epitope conservation across species

• Epitope-specific considerations:

  • Antibodies targeting highly conserved domains show better cross-species reactivity

  • The zinc-binding motifs and catalytic domains of ADH enzymes are typically more conserved than regulatory regions

  • Some antibodies are raised against human-specific regions and may fail in rodent models

• Species-validated antibodies:

  • Select antibodies specifically validated in target species of interest

  • Some antibodies show validated reactivity across multiple species:

    • Human, mouse, and rat (13288-2-AP)

    • Mouse, rat, and rabbit tissue samples (67709-1-Ig)

• Optimization strategies for cross-species applications:

  • Adjust antibody concentration (generally higher concentrations for non-validated species)

  • Modify incubation times (longer incubations may improve detection in non-validated species)

  • Customize blocking reagents based on species (consider species-specific serum for blocking)

• Alternative approaches for difficult species:

  • Consider species-specific antibodies when cross-reactive antibodies fail

  • For evolutionary distant species, custom antibody development may be necessary

  • Use orthogonal methods like mass spectrometry to confirm protein identity

• Species-specific positive controls:

  • Include known ADH6-expressing tissues from the target species

  • Consider recombinant ADH6 from the species of interest as a definitive control

  • Compare detection patterns across multiple tissues to confirm specificity

By implementing these strategies, researchers can more confidently detect ADH6 across different species and resolve discrepancies in experimental results.

How can ADH6 antibodies be applied in cancer research and therapeutic development?

ADH6 antibodies offer significant applications in cancer research, particularly through:

• Investigation of mutant p53 aggregation mechanisms:

  • A protein mimetic amyloid inhibitor named ADH-6 targets and dissociates mutant p53 aggregates in cancer cells

  • ADH6 antibodies can be used to track the expression and localization of this therapeutic target

  • They enable assessment of ADH-6 binding to mutant p53 through co-immunoprecipitation and immunofluorescence co-localization studies

• Tumor xenograft analysis:

  • ADH-6 treatment has shown efficacy in shrinking xenografts harboring mutant p53 with no toxicity to healthy tissue

  • ADH6 antibodies facilitate immunohistochemical analysis of treated tumors

  • They allow quantification of tissue-specific effects through immunostaining of tumor sections

• Mechanistic studies of p53 transcriptional activity restoration:

  • ADH-6 restores p53's transcriptional activity, leading to cell cycle arrest and apoptosis

  • ADH6 antibodies can be used in ChIP assays to detect p53 binding to target gene promoters

  • They enable correlation of ADH6 expression with p53 pathway activation markers

• Patient stratification biomarker development:

  • ADH6 expression patterns may correlate with tumor characteristics and patient outcomes

  • Immunohistochemistry using ADH6 antibodies on patient tissue microarrays can identify expression patterns

  • Such patterns could potentially identify patients most likely to respond to ADH-6 based therapies

• Therapeutic resistance mechanisms:

  • ADH6 antibodies can track changes in protein expression following treatment

  • Immunoprecipitation coupled with mass spectrometry can identify ADH6 interaction partners in resistant vs. sensitive cells

  • This approach may reveal novel resistance mechanisms and combination therapy targets

These applications demonstrate how ADH6 antibodies contribute to translational cancer research, from basic mechanistic studies to potential clinical applications.

What methodological approaches can link ADH6 to neuropsychiatric disorders?

Research has identified associations between common ADH variants and neuropsychiatric disorders, particularly schizophrenia and autism . Methodological approaches using ADH6 antibodies can help elucidate these connections:

• Genotype-phenotype correlation studies:

  • Combine ADH6 genetic variant analysis with protein expression quantification using antibodies

  • Compare ADH6 protein levels in post-mortem brain tissue from patients with different ADH6 genotypes

  • Identify whether risk variants alter protein expression, stability, or localization

• Brain region-specific expression analysis:

  • Use immunohistochemistry with ADH6 antibodies to map expression patterns across brain regions

  • Compare expression in neurotypical brains versus those affected by schizophrenia or autism

  • Identify cell type-specific expression through co-staining with neuronal, glial, or vascular markers

• Developmental expression profiling:

  • Track ADH6 expression during neurodevelopment using animal models

  • Analyze temporal and spatial expression patterns during critical developmental windows

  • Correlate expression with neurodevelopmental processes implicated in autism and schizophrenia

• Molecular interaction studies:

  • Use co-immunoprecipitation with ADH6 antibodies to identify protein interaction partners in neural tissue

  • Perform proximity ligation assays to visualize ADH6 interactions in situ

  • Identify disorder-specific alterations in protein interactions potentially contributing to pathology

• Functional studies in patient-derived models:

  • Generate induced pluripotent stem cells (iPSCs) from patients with schizophrenia or autism

  • Differentiate into neural lineages and analyze ADH6 expression patterns using antibodies

  • Manipulate ADH6 expression to determine effects on neuronal development and function

• MicroRNA regulatory network analysis:

  • Investigate interactions between ADH6 and microRNAs like Mir455 and Mir511

  • These interactions may influence neurodevelopmental processes relevant to schizophrenia and autism

  • Use ADH6 antibodies to confirm protein-level changes following microRNA manipulation

These methodological approaches provide frameworks for investigating the molecular mechanisms by which ADH6 variants might contribute to neuropsychiatric disorder risk.

How can researchers investigate interactions between ADH6 and its pseudogene Adh6-ps1?

Investigating interactions between ADH6 and its pseudogene Adh6-ps1 requires specialized methodological approaches using ADH6 antibodies:

• Pseudogene-specific expression analysis:

  • Design primers that distinguish between ADH6 and Adh6-ps1 transcripts

  • Use Western blot with ADH6 antibodies to determine if Adh6-ps1 is translated into protein

  • Compare expression patterns in different tissues, particularly in models of hepatocellular carcinoma (HCC) where Adh6-ps1 is moderately expressed

• MicroRNA competitive binding studies:

  • Adh6-ps1 interacts with multiple MirRNA markers, including Mir455 and Mir511

  • These interactions may involve competitive binding mechanisms affecting ADH6 regulation

  • Use RNA immunoprecipitation with ADH6 antibodies to identify associated miRNAs

  • Perform reporter assays to measure the effects of Adh6-ps1 expression on miRNA activity

• Cellular localization patterns:

  • Use immunofluorescence with ADH6 antibodies combined with RNA fluorescence in situ hybridization (FISH) for Adh6-ps1

  • Determine subcellular localization patterns and potential co-localization

  • Examine whether Adh6-ps1 affects ADH6 protein localization or stability

• Functional impact assessment:

  • Knockdown Adh6-ps1 using siRNA or CRISPR approaches

  • Measure changes in ADH6 protein levels using Western blot

  • Assess functional consequences on alcohol metabolism or other ADH6-dependent processes

• Notch signaling pathway investigation:

  • Adh6-ps1 may interact with the Notch signaling pathway, which plays roles in liver development and lipid metabolism

  • Use ADH6 antibodies in combination with Notch pathway component antibodies

  • Determine if ADH6 and Adh6-ps1 expression correlates with Notch pathway activation

• Cancer model investigations:

  • In DEN-induced HCC rat models, where Adh6-ps1 is expressed

  • Use ADH6 antibodies to track protein expression during cancer progression

  • Correlate with Mir455 and Mir511 expression, which are downregulated in HCC

These methodological approaches enable detailed investigation of the complex regulatory relationships between ADH6, its pseudogene Adh6-ps1, and associated miRNA networks in normal physiology and disease states.

What strategies can resolve non-specific binding and background issues with ADH6 antibodies?

Non-specific binding and high background are common challenges when working with ADH6 antibodies. These methodological approaches can help resolve these issues:

• Antibody selection optimization:

  • Compare monoclonal (e.g., clone 4G4, WW32) versus polyclonal antibodies

  • Monoclonals typically offer higher specificity with lower background

  • Test antibodies from different manufacturers targeting distinct epitopes

• Blocking protocol optimization:

  • Increase blocking time (1-2 hours at room temperature or overnight at 4°C)

  • Test different blocking agents (5% BSA, 5% non-fat dry milk, commercial blocking buffers)

  • For tissue sections, include 10% normal serum from the secondary antibody host species

• Antibody incubation conditions:

  • Dilute antibodies in fresh blocking buffer

  • Optimize concentration using titration experiments (starting with manufacturer recommendations)

  • Extend washing steps (5 washes of 5 minutes each) with mild agitation

• Tissue-specific optimizations:

  • For liver tissue (high ADH6 expression) , use more dilute antibody to reduce background

  • For tissues with lower expression, increase antibody concentration but implement more stringent washing

  • Consider antigen retrieval methods for fixed tissues (TE buffer pH 9.0 or citrate buffer pH 6.0)

• Specificity controls:

  • Perform peptide competition assays using the immunizing peptide

  • Include isotype controls (same isotype, irrelevant specificity) at the same concentration

  • Use tissue from ADH6-knockout models or siRNA knockdown samples as negative controls

• Cross-reactivity reduction:

  • Pre-absorb antibodies with acetone powder from tissues that don't express ADH6

  • Consider cross-adsorption against recombinant proteins of other ADH family members

  • Use sequential immunoprecipitation to deplete cross-reactive species

• Detection system optimization:

  • Use highly cross-adsorbed secondary antibodies to minimize species cross-reactivity

  • For fluorescence applications, include an autofluorescence quenching step

  • For IHC, use polymer detection systems rather than avidin-biotin to reduce background

Systematic application of these strategies can significantly improve signal-to-noise ratio when using ADH6 antibodies across various experimental platforms.

How should researchers interpret unexpected molecular weight bands when detecting ADH6?

When unexpected molecular weight bands appear in ADH6 detection, systematic interpretation and validation approaches should be employed:

• Expected versus observed molecular weights:

  • ADH6 has a calculated molecular weight of 39-40 kDa

  • Bands at different molecular weights require careful interpretation and validation

• Higher molecular weight bands (>40 kDa):

  • May represent post-translational modifications:

    • Potential phosphorylation site at S23 has been identified

    • Other potential modifications include glycosylation or ubiquitination

  • Could indicate protein complexes resistant to denaturation

  • May represent cross-reactivity with other ADH family members (ADH1-ADH5)

• Lower molecular weight bands (<40 kDa):

  • Potentially represent alternatively spliced isoforms of ADH6

  • May indicate proteolytic degradation products

  • Could represent cross-reactivity with ADH family members

  • For truncated bands, compare with computational predictions of potential cleavage products

• Validation approaches for unexpected bands:

  • Peptide competition assays: pre-incubation with immunizing peptide should eliminate specific bands

  • Comparison across multiple antibodies: true ADH6 bands should be detected by antibodies targeting different epitopes

  • Mass spectrometry validation: excise bands for protein identification

  • siRNA knockdown: specific bands should decrease in intensity after ADH6 knockdown

• Tissue and species-specific considerations:

  • Compare band patterns across tissues with known ADH6 expression (liver, stomach)

  • Species differences in ADH6 processing may result in different band patterns

  • Verify with recombinant ADH6 from the specific species as a size control

• Technical considerations affecting band patterns:

  • Sample preparation: harsh extraction methods may cause degradation

  • Reducing conditions: incomplete reduction can cause higher MW bands

  • Gel percentage: affects resolution of closely migrating bands

  • Heat denaturation: insufficient heating may result in incompletely denatured complexes

These methodological approaches enable proper interpretation of unexpected bands, distinguishing between true ADH6 variants and non-specific or artifactual signals.

What emerging technologies are advancing ADH6 antibody applications in biomedical research?

Several cutting-edge technologies are expanding the applications of ADH6 antibodies in biomedical research:

• Proximity-based protein interaction mapping:

  • Proximity ligation assays (PLA) using ADH6 antibodies can visualize protein-protein interactions in situ

  • BioID or APEX2 proximity labeling coupled with ADH6 antibodies for immunoprecipitation can identify novel interaction partners

  • These approaches could map the ADH6 interactome in different cellular contexts

• Single-cell protein analysis:

  • Mass cytometry (CyTOF) using metal-conjugated ADH6 antibodies enables high-dimensional single-cell protein analysis

  • Single-cell Western blotting can quantify ADH6 expression heterogeneity within tissues

  • These technologies reveal cell-to-cell variability in ADH6 expression previously masked in bulk analyses

• Super-resolution microscopy:

  • STORM/PALM techniques with fluorophore-conjugated ADH6 antibodies achieve ~20nm resolution

  • Expansion microscopy physically enlarges specimens for improved resolution with standard confocal microscopy

  • These approaches can reveal subcellular localization of ADH6 with unprecedented detail

• Proteogenomic integration:

  • Combining ADH6 antibody-based proteomics with genomic data to correlate genetic variants with protein expression

  • Spatial transcriptomics alongside immunofluorescence can map relationships between ADH6 mRNA and protein localization

  • These integrative approaches link genetic variation to functional consequences at the protein level

• Antibody engineering advances:

  • Recombinant antibody fragments (Fab, scFv) against ADH6 with improved tissue penetration

  • Site-specific conjugation chemistry for precisely labeled ADH6 antibodies

  • Bispecific antibodies targeting ADH6 and interacting partners simultaneously

• In vivo applications:

  • PET imaging using radiolabeled ADH6 antibodies to track expression in animal models

  • Intrabodies (intracellular antibodies) to manipulate ADH6 function in living cells

  • These approaches enable dynamic, non-invasive assessment of ADH6 expression

These emerging technologies are transforming ADH6 antibody applications from static, qualitative measurements to dynamic, quantitative, and spatially resolved analyses with greater functional insight.

How might research on ADH6 contribute to precision medicine approaches?

ADH6 research using antibody-based approaches has significant potential to contribute to precision medicine strategies:

• Pharmacogenomic applications:

  • ADH6 antibodies can quantify protein expression levels associated with specific genetic variants

  • Patients with different ADH6 expression levels may metabolize drugs differently

  • This could inform personalized dosing for medications metabolized by ADH enzymes

• Cancer therapeutic stratification:

  • ADH-6 treatment effectively shrinks xenografts harboring mutant p53

  • Immunohistochemical analysis using ADH6 antibodies could identify patients likely to respond

  • This approach could select candidates for therapies targeting mutant p53 aggregation

• Neuropsychiatric disorder biomarkers:

  • Common ADH variants are associated with schizophrenia and autism

  • ADH6 antibodies can quantify protein expression in accessible biospecimens

  • Expression patterns might serve as biomarkers for disease subtypes or treatment response

• Liquid biopsy development:

  • ADH6 antibodies could detect circulating protein in patient blood samples

  • Changes in levels might reflect disease progression or treatment response

  • This approach enables non-invasive monitoring of conditions linked to ADH6 function

• Targeted therapeutic development:

  • Understanding ADH6's role in disease through antibody-based studies informs drug targets

  • ADH6 antibodies can validate target engagement in drug development

  • Antibody-drug conjugates targeting ADH6 might deliver therapies to specific tissues

• Personalized risk assessment:

  • ADH6 expression patterns quantified by antibody-based methods might indicate disease susceptibility

  • Integration with genetic information could improve risk prediction models

  • This approach could inform preventive interventions for high-risk individuals

These precision medicine applications highlight how fundamental research on ADH6 using antibodies can translate to individualized patient care strategies across multiple disease contexts.