AIM29 Antibody

What is AIM29 and what cellular functions has it been associated with?

AIM29 (also known as C2orf76, LOC130355, or MGC104437) is a protein encoded by the C2orf76 gene located on chromosome 2 in humans. The protein has been identified through genomic and proteomic approaches, although its precise cellular functions remain under investigation. Current research suggests it may play roles in cellular processes, though complete functional characterization requires further investigation.

Based on sequence homology, there appears to be a related gene in yeast (Saccharomyces cerevisiae) also designated as AIM29, though the functional relationship between the yeast and human versions requires additional comparative studies . The human protein contains specific sequence motifs including the immunogen sequence "DALKIIHQAHKSKTNELVLSLEDDERLLLKEDSTLKAAGIASETEIAFFCEEDYRNYKANPISSW" that is used for antibody production .

What techniques are validated for AIM29 antibody applications?

Anti-AIM29 (C2orf76) antibodies have primarily been validated for immunofluorescence techniques with a recommended working concentration of 0.25-2 μg/mL . The Prestige Antibodies line, which includes anti-C2orf76 antibodies, undergoes extensive validation including:

• Immunohistochemistry testing on tissue arrays containing 44 normal human tissues and 20 common cancer types

• Protein array testing against 364 human recombinant protein fragments for cross-reactivity assessment

• Subcellular localization studies as part of the Human Protein Atlas project

Additional application testing might be required for techniques such as Western blot, flow cytometry, ELISA, or immunoprecipitation, as validation data for these methods may be limited.

How should researchers validate AIM29 antibody specificity in their experimental systems?

Researchers should employ multiple validation strategies based on the "five pillars" framework developed by the International Working Group for Antibody Validation:

• Genetic validation: Compare antibody binding signals between cells expressing AIM29 and control cells with AIM29 knocked out (CRISPR-based knockout preferred over RNAi) .

• Orthogonal validation: Measure target protein expression using an antibody-independent method (e.g., mass spectrometry) and correlate with antibody-based detection.

• Independent antibody validation: Use multiple antibodies targeting different epitopes of AIM29 and confirm similar staining patterns.

• Expression validation: Analyze whether antibody signal correlates with manipulated expression levels.

• Immunocapture mass spectrometry: Confirm that the antibody captures the intended target protein .

For conclusive validation, researchers should implement at least two different approaches, with genetic validation (comparing wild-type to knockout samples) being the gold standard when feasible.

What are optimal sample preparation protocols for immunofluorescence detection of AIM29?

For optimal immunofluorescence detection of AIM29 using anti-C2orf76 antibodies, researchers should follow these methodological considerations:

• Fixation: Standard 4% paraformaldehyde fixation (10-15 minutes at room temperature) is generally suitable, though optimization may be required.

• Permeabilization: Use 0.1-0.3% Triton X-100 for cell membrane permeabilization, with timing optimized to maintain cellular integrity while allowing antibody access.

• Blocking: Implement comprehensive blocking (typically 5-10% normal serum from the species of the secondary antibody) for 30-60 minutes to minimize background signal.

• Primary antibody incubation: Apply the anti-C2orf76 antibody at the recommended concentration range (0.25-2 μg/mL) and incubate overnight at 4°C for optimal signal-to-noise ratio .

• Controls: Always include appropriate negative controls (secondary antibody only, isotype control) and positive controls (tissues known to express AIM29) in parallel with experimental samples.

• Signal amplification: Consider tyramide signal amplification if target detection requires enhanced sensitivity.

These parameters should be systematically optimized for each specific experimental system and cell type.

How can researchers troubleshoot non-specific binding when using AIM29 antibodies?

When confronting non-specific binding issues with AIM29 antibodies, researchers should implement the following troubleshooting strategies:

The genetic validation approach remains the gold standard for distinguishing between specific and non-specific signals, as a true specific antibody should show no signal in cells lacking the target protein following CRISPR-mediated knockout .

What experimental approaches are suitable for studying AIM29 post-translational modifications?

To investigate post-translational modifications (PTMs) of AIM29, researchers should consider these methodological approaches:

• Specialized antibodies: While standard anti-C2orf76 antibodies target unmodified protein , researchers may need to develop or source antibodies that specifically recognize phosphorylated, acetylated, or otherwise modified forms of AIM29.

• Mass spectrometry approaches:

  • Immunoprecipitation coupled with MS analysis for PTM identification

  • Targeted MS approaches for quantification of specific modifications

  • SILAC labeling for comparing modified vs. unmodified protein ratios

• PTM enrichment strategies:

  • Phosphopeptide enrichment using TiO₂ or IMAC

  • Ubiquitination enrichment using TUBEs or di-Gly remnant antibodies

  • Acetylation enrichment with anti-acetyllysine antibodies

• Inhibitor studies: Treatment with kinase/phosphatase inhibitors, deacetylase inhibitors, or proteasome inhibitors to modulate specific PTM pathways, followed by AIM29 detection.

• Site-directed mutagenesis: Generation of potential PTM site mutants to assess functional consequences.

These approaches can reveal both the presence and functional significance of AIM29 post-translational modifications.

What are the recommended positive and negative control samples for AIM29 antibody validation?

For rigorous validation of AIM29 antibody specificity, researchers should implement the following control strategy:

Positive Controls:

• Human tissue samples with known AIM29 expression (based on RNA-seq or proteomics data)

• Cell lines with confirmed AIM29 expression (potentially available in Human Protein Atlas data)

• Recombinant AIM29 protein as a Western blot standard

• Cells transfected with AIM29 expression constructs (for overexpression controls)

Negative Controls:

• CRISPR-engineered C2orf76 knockout cell lines (gold standard)

• Samples from unrelated species if AIM29 is not conserved

• Secondary antibody-only controls to detect non-specific binding

• Peptide competition controls using the immunizing peptide sequence (DALKIIHQAHKSKTNELVLSLEDDERLLLKEDSTLKAAGIASETEIAFFCEEDYRNYKANPISSW)

The comparison between these controls allows definitive assessment of antibody specificity and suitable working conditions across different experimental techniques.

How can researchers quantitatively assess AIM29 expression levels across different samples?

For quantitative assessment of AIM29 expression, researchers should consider these methodological approaches:

• Immunofluorescence quantification:

  • Standardize image acquisition settings (exposure, gain)

  • Employ automated image analysis software (CellProfiler, ImageJ)

  • Normalize signal to cellular area or nuclear count

  • Include reference standards in each experiment

• Western blot quantification:

  • Use recombinant protein standards for absolute quantification

  • Apply appropriate loading controls (housekeeping proteins)

  • Employ LI-COR or similar systems for linear dynamic range

  • Validate by comparison with mRNA quantification

• Flow cytometry approaches:

  • Use antibody calibration beads to establish absolute binding capacities

  • Implement appropriate isotype controls

  • Evaluate median fluorescence intensity ratios

• Mass spectrometry-based quantification:

  • Employ stable isotope-labeled peptide standards

  • Use data-independent acquisition methods

  • Compare peptide abundances across multiple unique peptides

For each quantitative method, researchers should establish technical reproducibility through appropriate replication and statistical analysis to ensure reliable expression comparisons across experimental conditions.

What is the optimal protocol for dual immunostaining experiments involving AIM29 antibodies?

When designing dual immunostaining experiments involving AIM29 detection, researchers should implement the following methodological approach:

• Primary antibody selection:

  • Choose AIM29 antibody and co-staining antibody from different host species (rabbit anti-C2orf76 paired with mouse antibody for co-target)

  • If same-species antibodies are unavoidable, use directly conjugated antibodies or sequential immunostaining protocols

• Cross-reactivity prevention:

  • Test each antibody individually before combination

  • Implement adequate blocking between sequential staining steps

  • Consider using Fab fragments to block exposed IgG epitopes

• Signal separation optimization:

  • Choose fluorophores with minimal spectral overlap

  • Implement appropriate single-color controls

  • Utilize spectral unmixing for closely related fluorophores

  • Include absorption controls to verify absence of bleed-through

• Signal balancing:

  • Titrate both antibodies to achieve comparable signal intensities

  • Optimize exposure settings for balanced visualization

  • Consider the subcellular distribution of both targets when selecting imaging parameters

• Validation controls:

  • Include single-stained controls for each antibody

  • Implement secondary antibody-only controls

  • Validate staining patterns with orthogonal methods or genetic approaches

This systematic approach ensures reliable simultaneous detection of AIM29 and other proteins of interest while minimizing artifacts.

How should conflicting AIM29 localization data from different antibodies be reconciled?

When researchers encounter conflicting localization data for AIM29 using different antibodies, a systematic reconciliation approach is essential:

• Antibody validation assessment:

  • Evaluate the validation methods used for each antibody

  • Prioritize data from antibodies validated through genetic approaches (knockout controls)

  • Consider evidence from antibodies targeting different epitopes

  • Review the validation data available through resources like the Human Protein Atlas

• Orthogonal confirmation:

  • Generate fluorescent protein-tagged AIM29 constructs for live-cell imaging

  • Perform cell fractionation followed by Western blot analysis

  • Use proximity labeling approaches (BioID, APEX) to confirm localization

  • Consider mass spectrometry-based spatial proteomics

• Technical factors evaluation:

  • Assess fixation methods (paraformaldehyde vs. methanol can affect epitope accessibility)

  • Consider permeabilization conditions (detergent types/concentrations)

  • Evaluate antibody concentrations and incubation conditions

  • Analyze imaging parameters (resolution limits, signal-to-noise ratio)

• Biological context consideration:

  • Determine if localization might be cell-type dependent

  • Assess whether localization changes under specific conditions (stress, cell cycle)

  • Consider potential splice variants with different localization patterns

  • Evaluate the effect of post-translational modifications on localization

By systematically addressing these factors, researchers can resolve conflicting localization data and develop an integrated understanding of AIM29's true subcellular distribution.

What statistically robust approaches should be used for quantifying AIM29 expression changes between experimental conditions?

For statistically sound quantification of AIM29 expression changes, researchers should implement these analytical approaches:

• Experimental design considerations:

  • Power analysis to determine appropriate sample sizes

  • Randomization and blinding where applicable

  • Inclusion of technical and biological replicates

  • Consideration of batch effects and appropriate controls

• Quantification methodologies:

  • Densitometry for Western blot (with linear dynamic range validation)

  • Mean fluorescence intensity or integrated density for immunofluorescence

  • Normalized spectral counts or intensity-based methods for proteomics

• Statistical analysis framework:

  • Normality testing before selecting parametric/non-parametric tests

  • Multiple comparison correction for experiments with >2 conditions

  • ANOVA with post-hoc tests for multi-group comparisons

  • Linear mixed models to account for random effects

• Presentation standards:

  • Report exact p-values rather than thresholds

  • Include error bars representing standard deviation or standard error

  • Present individual data points alongside means

  • Report effect sizes alongside statistical significance

This methodological framework ensures that observed changes in AIM29 expression between conditions reflect biological reality rather than technical artifacts or statistical anomalies.

How can researchers distinguish between specific AIM29 signal and technical artifacts in immunohistochemistry experiments?

Distinguishing specific AIM29 signal from technical artifacts in immunohistochemistry requires systematic implementation of these methodological controls:

• Genetic validation controls:

  • Compare staining between wild-type and C2orf76 knockout samples

  • Include gradients of expression (heterozygous samples, knockdown samples)

  • Use inducible expression systems to create controlled expression levels

• Technical control panel:

  • Primary antibody omission control

  • Isotype control at equivalent concentration

  • Absorption control (pre-incubation with immunizing peptide)

  • Secondary antibody-only control

• Pattern analysis approach:

  • Compare staining pattern to expected subcellular localization

  • Assess staining in tissues with known expression vs. non-expressing tissues

  • Evaluate consistency across multiple samples and across antibody lots

  • Compare with in situ hybridization data for mRNA localization

• Artifact identification criteria:

  • Edge effects and tissue folding artifacts

  • Nuclear halo artifacts from excessive antigen retrieval

  • Necrotic tissue non-specific binding

  • Endogenous peroxidase or biotin activity

• Multi-method validation:

  • Confirm key findings with orthogonal detection methods

  • Use multiple antibodies targeting different epitopes

  • Implement fluorescence microscopy with confocal evaluation

  • Consider RNAscope or similar techniques for transcript detection

By implementing this comprehensive approach to artifact identification, researchers can confidently distinguish genuine AIM29 expression patterns from technical artifacts.

What methodologies are appropriate for studying AIM29 protein-protein interactions?

To study AIM29 protein-protein interactions, researchers should consider implementing these advanced methodological approaches:

• Affinity purification coupled with mass spectrometry (AP-MS):

  • Immunoprecipitation using validated anti-C2orf76 antibodies

  • Tandem affinity purification with tagged AIM29 constructs

  • SILAC or TMT labeling for quantitative interaction analysis

  • Crosslinking mass spectrometry for transient interactions

• Proximity-based labeling methods:

  • BioID fusion (AIM29-BirA*) for proximal protein biotinylation

  • APEX2 fusion for peroxidase-based proximity labeling

  • TurboID for rapid labeling of neighboring proteins

  • Split-BioID for conditional interaction detection

• Fluorescence-based interaction studies:

  • Förster resonance energy transfer (FRET) between AIM29 and candidate partners

  • Fluorescence lifetime imaging microscopy (FLIM) for interaction confirmation

  • Bimolecular fluorescence complementation (BiFC) for direct binding validation

  • Fluorescence correlation spectroscopy (FCS) for dynamic interaction analysis

• Biochemical interaction validation:

  • In vitro binding assays with recombinant proteins

  • Surface plasmon resonance for binding kinetics determination

  • Isothermal titration calorimetry for thermodynamic parameters

  • Mammalian two-hybrid system for interaction confirmation

These complementary approaches can provide a comprehensive understanding of the AIM29 interactome, revealing both stable and transient protein-protein interactions in relevant cellular contexts.

What are the considerations for developing high-affinity monoclonal antibodies against AIM29?

For developing high-affinity monoclonal antibodies against AIM29, researchers should consider this methodological framework:

• Antigen design strategy:

  • Full-length recombinant protein vs. selected peptide epitopes

  • Consider using the validated immunogen sequence (DALKIIHQAHKSKTNELVLSLEDDERLLLKEDSTLKAAGIASETEIAFFCEEDYRNYKANPISSW)

  • Evaluate epitope conservation across species if cross-reactivity is desired

  • Assess structural accessibility of potential epitopes

• Immunization protocol optimization:

  • Use NP-CGG or similar carrier conjugation for enhanced immune response

  • Implement prime-boost strategies with varied adjuvants

  • Consider genetic immunization approaches for conformational epitopes

  • Schedule timed blood sampling to monitor affinity maturation

• B-cell selection methodology:

  • Single memory B-cell isolation from immunized mice

  • Antigen-specific B-cell sorting by flow cytometry

  • Implementation of rapid, high-throughput screening protocols

  • Assessment of NP2/NP21 binding ratios to identify high-affinity clones

• Expression system considerations:

  • Optimal heavy chain:light chain ratio (1:2 weight ratio) for maximal expression

  • Co-expression of J chain for IgM and IgA to ensure proper multimeric structure

  • Co-expression of secretory component for stable secretory IgA production

  • Expi293F cell system optimization for high-yield antibody production

• Affinity maturation assessment:

  • Differential binding to low vs. high valency antigens

  • Surface plasmon resonance for direct affinity measurement

  • Competitive binding assays against existing antibodies

  • Functional assays to assess biological activity

This systematic approach can yield high-affinity monoclonal antibodies against AIM29 within approximately 6 days, enabling rapid development for research applications .

How can researchers apply AIM29 antibodies in multiplexed imaging systems?

For implementing AIM29 antibodies in multiplexed imaging systems, researchers should consider these advanced methodological approaches:

• Antibody conjugation strategies:

  • Direct fluorophore conjugation (AlexaFluor, DyLight, Cy dyes)

  • Metal isotope labeling for mass cytometry (CyTOF)

  • DNA-barcoded antibodies for CODEX or similar technologies

  • Click chemistry-compatible modifications for post-staining conjugation

• Sequential multiplexing methods:

  • Cyclic immunofluorescence with antibody stripping or quenching

  • Multi-epitope ligand cartography (MELC)

  • Iterative indirect immunofluorescence imaging (4i)

  • Signal removal through photobleaching or chemical inactivation

• Spectral unmixing considerations:

  • Selection of spectrally separated fluorophores

  • Linear unmixing algorithms for overlapping spectra

  • Reference spectra acquisition for each fluorophore

  • Autofluorescence subtraction strategies

• Spatial analysis applications:

  • Co-localization analysis with subcellular markers

  • Neighborhood analysis in tissue contexts

  • Single-cell spatial transcriptomics correlation

  • 3D reconstruction from serial sections

• Data analysis frameworks:

  • Machine learning for pattern recognition

  • Cell segmentation algorithms for quantitative analysis

  • Dimensionality reduction for visualization (tSNE, UMAP)

  • Spatial statistics for distribution analysis