ANKS6 antibodies are immunological reagents designed to specifically detect and bind to the ANKS6 protein in various experimental applications. These antibodies have become essential tools in both basic science research and clinical investigations related to kidney development and disease. They are produced in multiple host species and are available in various formulations to suit different experimental needs . The development of specific antibodies against ANKS6 has facilitated significant breakthroughs in understanding the protein's role in ciliopathies and renal diseases, particularly nephronophthisis .
Research interest in ANKS6 antibodies has grown substantially following discoveries linking ANKS6 to a network of nephronophthisis-associated proteins. These antibodies have enabled researchers to trace the subcellular localization of ANKS6, study its interactions with other proteins, and investigate its functions in normal and pathological conditions .
ANKS6 antibodies are available in multiple formats, each with specific characteristics suited to different experimental applications. These antibodies vary in their host species, clonality, target epitopes, and conjugation status.
The majority of commercially available ANKS6 antibodies are produced in rabbits as polyclonal antibodies, though mouse monoclonal options are also available . Polyclonal antibodies, generated by immunizing rabbits with synthetic peptides or recombinant proteins corresponding to specific regions of human ANKS6, offer the advantage of recognizing multiple epitopes on the target protein . In contrast, monoclonal antibodies like the mouse monoclonal A-1 provide high specificity for a single epitope .
Different ANKS6 antibodies target various regions of the protein. For example, some antibodies are generated against synthetic peptides corresponding to amino acids 505-534 from the central region of human ANKS6, while others target amino acids 1-132 . Some products utilize recombinant proteins as immunogens, targeting specific sequences such as "TSTTSKSTSPTLTPSPSPKGHTAESSVSSSSSHRQSKSSGGSSSGTITDEDELTGILKKLSLEKYQPIFEEQEVDMEAFLTLTDGDLKELGIKTDGSRQQILAAISELNAGKGRERQILQETIHNFHSSF" .
ANKS6 antibodies are available in both unconjugated forms and conjugated to various molecules to enhance detection:
Unconjugated (primary) antibodies for flexible detection methods
Horseradish peroxidase (HRP)-conjugated for enhanced chemiluminescent detection
Fluorescent conjugates including FITC for direct fluorescence imaging
Biotin-conjugated antibodies for signal amplification systems
Multiple Alexa Fluor® conjugates for advanced fluorescence applications
Understanding the characteristics and functions of the target protein is crucial for effective application of ANKS6 antibodies in research.
ANKS6 (Ankyrin Repeat and Sterile alpha Motif Domain Containing 6) is a 871 amino acid phosphoprotein in humans with a molecular mass of approximately 92.2 kDa . The protein is characterized by eleven ankyrin repeats and one sterile alpha motif domain, existing in three alternatively spliced isoforms . This structural arrangement is crucial for its protein-protein interaction functions, particularly in the formation of multiprotein complexes within the ciliary inversin compartment .
ANKS6 displays a specific subcellular distribution, predominantly localizing to:
Importantly, ANKS6 requires NEK8 (NPHP9) for proper localization to the ciliary inversin compartment, highlighting the interdependence of these proteins in the nephronophthisis module .
ANKS6 plays crucial roles in several biological processes:
It functions as a central component of a nephronophthisis module, linking NEK8 to INVERSIN and NPHP3
It serves as an activator of NEK8 kinase, stimulating its phosphorylation activity
The protein is essential for normal cardiovascular development
It participates in a network controlling embryonic situs determination (organ laterality)
ANKS6 antibodies have been employed in various experimental techniques to investigate the expression, localization, and function of ANKS6 protein.
Western blotting represents one of the most common applications for ANKS6 antibodies, allowing researchers to detect and analyze ANKS6 protein expression in various tissues and cell types . This technique enables the assessment of protein size, expression levels, and post-translational modifications. Recommended dilutions for Western blotting typically range from 1:100 to 1:2000, depending on the specific antibody .
ANKS6 antibodies are widely used in immunohistochemistry and immunocytochemistry to visualize the spatial distribution of ANKS6 in tissues and cells . These techniques have been instrumental in determining the localization of ANKS6 to the proximal cilium and other subcellular compartments. Typical dilutions for these applications range from 1:10 to 1:500 for immunohistochemistry and 0.25-2 μg/ml for immunocytochemistry/immunofluorescence .
ANKS6 antibodies are suitable for enzyme-linked immunosorbent assays (ELISA) to quantify ANKS6 levels in biological samples . Additionally, certain antibodies like the Santa Cruz A-1 monoclonal antibody can be used for immunoprecipitation to isolate ANKS6 protein complexes for further analysis . These techniques have been valuable for studying ANKS6 interactions with other proteins in the nephronophthisis module.
| Application | Typical Dilution Range |
|---|---|
| Western Blotting | 1:100 - 1:2000 |
| Immunohistochemistry | 1:10 - 1:500 |
| Immunocytochemistry/Immunofluorescence | 0.25-2 μg/ml |
| ELISA | Varies by antibody |
Research utilizing ANKS6 antibodies has led to significant discoveries regarding the biological roles of ANKS6 and its implications in disease.
Nephronophthisis (NPH) is an autosomal recessive cystic kidney disease leading to renal failure in childhood or adolescence. ANKS6 has been identified as a new member of the NPH protein family, connecting NEK8 (NPHP9) to INVERSIN (INVS, NPHP2) and NPHP3 to form a distinct NPHP module . Studies using ANKS6 antibodies have revealed that mutations in ANKS6 can cause phenotypes similar to other NPH gene mutations, including cystic kidneys and cardiovascular malformations .
ANKS6 antibodies have been instrumental in elucidating the role of ANKS6 in cellular signaling pathways. Research has identified ANKS6 as both a target and activator of NEK8 kinase . This relationship is crucial for embryonic situs determination and kidney development. The ANKS6-NEK8 interaction appears to be part of a larger signaling network that controls organ laterality and renal tubular structure .
Affinity proteomics screens using ANKS6 antibodies for immunoprecipitation have revealed that ANKS6 participates in a complex protein network. This network includes not only NEK8, INVS, and NPHP3 but also mitochondrial proteins, NEK7, and the ankyrin repeat protein ANKS3 . This suggests that ANKS6 may function at the intersection of ciliary and mitochondrial signaling pathways.
Validated ANKS6 antibodies have been tested in specific applications and cited in research publications. For example, some ANKS6 antibodies from Novus Biologicals have been used in three publications . Validation data typically includes Western blot results demonstrating specificity, immunofluorescence images showing expected localization patterns, and other application-specific tests.
ANKS6 antibodies vary in their species reactivity profiles. While many antibodies react with human, mouse, and rat ANKS6, some also offer reactivity with zebrafish ANKS6 . Confirming species reactivity is crucial when planning experiments with animal models or cell lines from specific species.
ANKS6 antibodies continue to play a vital role in advancing our understanding of this protein's functions and its implications in disease. Future research directions may include:
As ANKS6 is implicated in nephronophthisis and potentially other ciliopathies, antibodies against ANKS6 may contribute to the development of diagnostic tools and therapeutic strategies for these conditions. Further research into the specific pathways disrupted by ANKS6 mutations could reveal targetable mechanisms for intervention.
Continued investigation of ANKS6 interaction partners using antibody-based approaches such as co-immunoprecipitation followed by mass spectrometry may reveal additional components of the ANKS6-containing protein complexes. This could provide deeper insights into the broader signaling networks in which ANKS6 participates.
ANKS6, or Ankyrin Repeat and Sterile alpha Motif Domain Containing 6, is a protein with significant roles in cellular function and disease pathology. In humans, the canonical ANKS6 protein consists of 871 amino acid residues with a molecular mass of 92.2 kDa . It localizes primarily in cell projections and cytoplasm and exists in up to three different isoforms . ANKS6 is widely expressed across various tissue types and plays a crucial role in renal function .
Research interest in ANKS6 stems from its association with nephronophthisis, a genetic kidney disease characterized by renal cysts and progressive kidney failure . ANKS6 serves as a central component of a nephronophthisis module that links several NPHP-associated proteins, including NEK8, INVS, and NPHP3 . This network controls normal renal and cardiovascular development, making ANKS6 antibodies essential tools for studying these developmental processes and associated pathologies.
When searching literature or databases for ANKS6-related information, researchers should be aware of several synonyms:
SAM domain-containing protein 6
Ankyrin repeat domain 14
samCystin
ANKS6 is highly conserved across species, with orthologs reported in:
Mouse (Mus musculus)
Rat (Rattus norvegicus)
Bovine (Bos taurus)
Frog (Xenopus species)
Chimpanzee (Pan troglodytes)
These orthologs enable comparative studies across different model organisms to understand conserved functions of ANKS6.
ANKS6 antibodies serve multiple experimental applications in research settings:
| Application | Common Usage | Species Reactivity |
|---|---|---|
| Immunohistochemistry (IHC) | Widely used for tissue localization studies | Human, Mouse, Rat |
| Western Blot (WB) | Protein expression and molecular weight determination | Human, Mouse |
| Enzyme-Linked Immunosorbent Assay (ELISA) | Quantitative protein detection | Human, Mouse, Rat |
| Immunofluorescence (IF) | Subcellular localization studies, particularly in cilia | Human, Mouse, Rat |
The choice of application depends on the specific research question, with immunohistochemistry being particularly prevalent in ANKS6 research due to its importance in understanding tissue expression patterns .
ANKS6 plays a critical role in ciliary function through its interactions with other ciliary proteins. Research has shown that ANKS6 localizes to the proximal segment of cilia in a manner dependent on INVS (Inversin) . In Invs-depleted IMCD3 cells, endogenous Anks6 is lost from the proximal segment of cilia without affecting total Anks6 protein levels .
ANKS6 functions as an organizer of a distinct NPHP (nephronophthisis) protein module by linking INVS and NPHP3 to NEK8 . This module is essential for normal ciliary function and signaling. Disruption of this complex through mutations or altered protein interactions can lead to ciliopathies characterized by renal and cardiovascular abnormalities .
ANKS6 undergoes hydroxylation, a critical post-translational modification that affects its protein-protein interactions. Mass spectrometry has detected hydroxylated peptides at asparagine N129 of Anks6, mediated by the asparaginyl-hydroxylase HIF1AN (Factor Inhibiting HIF, FIH) . This oxygen-dependent hydroxylation appears to alter the composition of the ANKS6 complex.
When designing experiments with ANKS6 antibodies, researchers should consider:
Antibody epitope location: Antibodies targeting regions near modification sites may show differential binding depending on the modification state
Experimental conditions: Hypoxic conditions may alter HIF1AN-mediated hydroxylation of ANKS6
Protein interactions: Mutation of hydroxylation sites in ANKS6 results in decreased binding to NEK8
For studies focusing on ANKS6 interactions, researchers should validate whether their antibodies can detect both modified and unmodified forms of the protein, as this may significantly impact experimental outcomes and interpretation.
Detecting ANKS6 in different subcellular compartments requires careful optimization of experimental conditions:
For ciliary localization studies:
Cell fixation method: Paraformaldehyde (4%) preservation of ciliary structures is critical
Permeabilization: Mild detergents (0.1-0.2% Triton X-100) maintain ciliary architecture
Co-staining markers: Include acetylated tubulin to mark cilia and verify ANKS6 localization to the proximal ciliary segment
INVS status: Consider that ANKS6 localization depends on INVS, as ANKS6 is lost from proximal cilia in INVS-depleted cells
For cytoplasmic detection:
Use antibodies targeting central regions (e.g., AA 505-534) of ANKS6
Consider subcellular fractionation before Western blotting to enrich cytoplasmic fractions
For optimal results, researchers should validate their antibodies in both wild-type tissues/cells and those with altered ANKS6 expression or mutation to confirm specificity.
ANKS6 mutations can significantly impact antibody epitope recognition, particularly missense mutations that alter protein conformation or post-translational modifications:
The Gln441Arg mutation (identified in patient B7397) presents a model case: while this mutation didn't alter interaction with other NPHP proteins or ciliary localization , it failed to rescue the renal phenotype in Xenopus models . This suggests that:
Structurally conserved mutations may maintain epitope recognition by antibodies targeting distant regions
Functional changes may occur despite preserved antibody binding
Researchers should validate antibodies against both wild-type and mutant proteins
When studying patient samples with known ANKS6 mutations, researchers should:
Choose antibodies targeting epitopes distant from mutation sites
Consider using multiple antibodies targeting different regions of ANKS6
Include appropriate positive and negative controls for validation
This approach ensures reliable detection regardless of potential conformational changes induced by mutations.
The interaction between ANKS6, ANKS3, and Bicc1 represents a complex regulatory network with significant implications for experimental design:
Recent structure-function analysis reveals that ANKS3 can either inhibit or promote the binding of target mRNAs depending on its conformation and regulation by ANKS6 . Specifically:
The C-terminal coiled-coil domain of ANKS3 interacts with Bicc1
This interaction inhibits binding of target mRNAs
ANKS6 regulates this inhibitory effect by modulating ANKS3 conformation
When studying any component of this network, researchers should consider:
The multivalent nature of these protein interactions
The dynamic regulation of RNA binding
The potential impact on ribonucleoparticle (RNP) formation
Experimental approaches might include co-immunoprecipitation with antibodies against different components, in vitro reconstitution of complexes, and assessment of RNA binding in the presence of various protein combinations.
Validating ANKS6 antibody specificity is crucial for generating reliable research results:
Genetic validation approaches:
ANKS6 knockout/knockdown controls: Use CRISPR/Cas9-mediated knockout or siRNA knockdown of ANKS6 to confirm antibody specificity
Overexpression systems: Test antibody recognition of tagged recombinant ANKS6 proteins
Biochemical validation:
Tissue validation:
Including proper validation steps prevents misinterpretation of data and ensures the reliability of experimental findings.
Selecting the optimal ANKS6 antibody requires careful consideration of several factors:
Epitope targeting:
For studying protein interactions: Choose antibodies targeting regions away from interaction domains
For post-translational modifications: Select antibodies that can discriminate between modified and unmodified states
For isoform-specific detection: Use antibodies targeting unique regions of specific isoforms
Application-specific considerations:
For Western blot: Antibodies targeting AA 505-534 from the central region have shown good results
For immunohistochemistry: Consider whether the epitope is preserved after fixation procedures
For immunoprecipitation: Verify that the antibody doesn't interfere with protein-protein interactions of interest
Species reactivity:
Confirm cross-reactivity with the model organism being studied
Consider evolutionary conservation of the epitope region across species
Researchers should review available validation data and published literature using specific antibodies before making their selection.
When investigating ANKS6 interactions with other NPHP proteins, several critical controls must be included:
Input controls:
Expression level verification: Confirm equal expression of all proteins under study
Subcellular localization: Verify proper localization of proteins before interaction studies
Protein solubility: Ensure extraction conditions maintain native protein conformations
Interaction-specific controls:
Negative controls: Include non-interacting proteins with similar properties
Competition assays: Use excess untagged protein to compete with tagged protein
Domain deletion/mutation: Test specific domains/residues required for interaction
HIF1AN activity: Consider the role of hydroxylation in mediating interactions
Validation across methods:
Reciprocal co-immunoprecipitation experiments
Proximity ligation assays for in situ verification
In vitro binding assays with purified components
These controls help distinguish specific interactions from experimental artifacts and provide robust evidence for physical associations between ANKS6 and other NPHP module components.
ANKS6 antibodies play a crucial role in nephronophthisis research by enabling multiple investigative approaches:
Pathological assessment:
Immunohistochemical staining of patient kidney biopsies
Evaluation of ANKS6 expression and localization in cystic versus normal tissue
Comparison between wild-type and mutant ANKS6 localization patterns
Molecular mechanism studies:
Diagnostic development:
Identifying ANKS6 mislocalization as a potential biomarker
Developing immunoassays for detecting mutant forms
Creating antibody-based screening methods for high-risk populations
By enabling these applications, ANKS6 antibodies facilitate both basic understanding of disease mechanisms and translational advances in nephronophthisis research.
ANKS6 mutations have been linked to cardiovascular abnormalities, including aortic stenosis, pulmonary stenosis, and obstructive cardiomyopathy . ANKS6 antibodies can provide valuable insights into these conditions:
Developmental studies:
Tracking ANKS6 expression during cardiac development
Identifying critical time points when ANKS6 function affects heart morphogenesis
Comparing normal versus aberrant cardiac developmental trajectories
Tissue-specific analyses:
Characterizing ANKS6 expression patterns in different heart regions
Correlating mislocalization with specific structural defects
Investigating cell-type specific effects in cardiac tissues
Mechanistic investigations:
Determining whether cardiovascular phenotypes result from primary ANKS6 dysfunction or secondary effects
Exploring relationships between ANKS6 and other proteins linked to cardiac development
Examining potential therapeutic targets within the ANKS6 pathway
These investigations may clarify why specific ANKS6 mutations (like those in patients A3114, B6794, A649, and NPH316) manifest as cardiovascular defects rather than solely renal abnormalities .
The discovery that ANKS6 interacts with HIF1AN (an oxygen sensor that hydroxylates ANKS6) opens new research directions linking oxygen sensing to ciliopathies:
Hydroxylation-specific detection:
Developing antibodies specifically recognizing hydroxylated ANKS6 at asparagine N129
Mapping hydroxylation patterns across tissues and developmental stages
Comparing hydroxylation status between normal and disease states
Hypoxia response studies:
Investigating how oxygen levels affect ANKS6 complex formation
Determining whether hypoxia-induced changes in ANKS6 hydroxylation contribute to disease
Exploring potential therapeutic interventions targeting this pathway
Mechanistic investigations:
These approaches could reveal novel connections between environmental oxygen sensing and developmental disorders, potentially identifying new therapeutic strategies for ciliopathies.
Non-specific binding is a common challenge when working with ANKS6 antibodies. Researchers can implement several strategies to minimize this issue:
Blocking optimization:
Test different blocking agents (BSA, milk, normal serum)
Increase blocking concentration (3-5% instead of standard 1%)
Extend blocking time (2 hours to overnight)
Add 0.1-0.3% Triton X-100 to reduce hydrophobic interactions
Antibody dilution optimization:
Perform titration experiments to determine optimal concentration
Consider using higher dilutions than manufacturer recommendations
Extend primary antibody incubation time at lower concentrations
Sample-specific considerations:
For tissues with high endogenous biotin, use biotin-blocking systems
Pre-adsorb antibodies with tissues from knockout models if available
Perform antigen retrieval optimization for fixed tissues
These approaches should be systematically tested and documented to establish reliable protocols for specific experimental systems.
Detecting ANKS6 in tissues with low expression levels requires specialized approaches:
Signal amplification methods:
Tyramide signal amplification (TSA) for immunohistochemistry/immunofluorescence
Enhanced chemiluminescence substrates for Western blotting
Biotin-streptavidin amplification systems
Sample enrichment techniques:
Subcellular fractionation to concentrate relevant compartments
Immunoprecipitation before Western blotting
Proximity ligation assay for detecting protein interactions with higher sensitivity
Technical considerations:
Extended exposure times for Western blots
Digital image enhancement with appropriate controls
Use of highly sensitive cameras for immunofluorescence
These methodological adaptations can significantly improve detection of low-abundance ANKS6 while maintaining experimental rigor and reproducibility.
Discrepancies between different ANKS6 antibodies are not uncommon and may reflect biological phenomena rather than technical artifacts:
Possible biological explanations:
Isoform-specific detection: Different antibodies may recognize distinct ANKS6 isoforms
Post-translational modifications: Some epitopes may be masked by modifications
Protein interactions: Certain antibodies may be unable to access epitopes in protein complexes
Conformational states: ANKS6 may adopt different conformations in various contexts
Verification approaches:
Use multiple antibodies targeting different regions
Compare monoclonal and polyclonal antibodies
Validate with genetic approaches (overexpression, knockdown)
Perform epitope mapping studies
Reporting considerations:
Document all antibodies used (catalog numbers, dilutions)
Specify epitope regions and detection methods
Acknowledge limitations in interpretation
Consider the biological significance of discrepancies
By treating discrepancies as potentially informative rather than merely problematic, researchers can gain deeper insights into ANKS6 biology and function.