ANXA13 Antibody

What is ANXA13 and what are its key characteristics?

ANXA13 (Annexin A13) is a Ca²⁺-dependent phospholipid-binding protein of the annexin superfamily. It functions in cellular growth regulation and signal transduction pathways. The human version has a canonical amino acid length of 316 residues and a protein mass of 35.4 kilodaltons with two identified isoforms . It is considered the probable common ancestor of all vertebrate annexins based on its unique, conserved primary structure and gene organization . ANXA13 is primarily localized in cytoplasmic vesicles and cell membranes, and is notably expressed in tissues such as the appendix and duodenum .

What are the standard applications for ANXA13 antibodies?

ANXA13 antibodies are validated for multiple experimental applications:

These applications allow researchers to detect and measure ANXA13 antigen in biological samples . When performing IHC, antigen retrieval with TE buffer (pH 9.0) is suggested, though citrate buffer (pH 6.0) can be used as an alternative .

How should I validate the specificity of ANXA13 antibodies?

Validating antibody specificity is crucial for reliable results. A multi-step approach is recommended:

• Positive and negative control tissues: Use tissues known to express ANXA13 (like small intestine or appendix) as positive controls and low-expressing tissues as negative controls .

• Western blot validation: Confirm a single band of approximately 35.4 kDa (or 2 bands if detecting both isoforms) .

• siRNA knockdown control: Use siRNA targeting ANXA13 to create a negative control. The following validated siRNA sequences have been used successfully:

  • ANXA13-homo-I: 5′-GCUGAACAAAGCCUGCAAATT-3′ (sense)

  • ANXA13-homo-II: 5′-GCCUCGAAUCAGAUGUCAATT-3′ (sense)

  • ANXA13-homo-III: 5′-CCUUUCAAGCCUAUCAAAUTT-3′ (sense)

• Immunogen peptide blocking: Pre-incubate the antibody with the immunogen peptide (RHSQSYTLSEGSQQLPKGDSQPSTVVQPLSHPSRNGEPEAPQPAKASSPQGFDVDRDAKKLNKACKGMGTN) to verify signal specificity .

How can I effectively study ANXA13's role in cancer progression?

ANXA13 has been implicated in multiple cancer types, including colorectal cancer (CRC), lung adenocarcinoma, and clear cell renal cell carcinoma (ccRCC) . To study its role:

What are the optimal conditions for detecting ANXA13 in western blotting?

For optimal western blot detection of ANXA13:

• Sample preparation: Extract proteins using standard protocols with protease inhibitors to prevent degradation.

• Blocking and antibody incubation:

  • Block membranes with 10% skim milk for 2 hours at room temperature

  • Incubate with primary anti-ANXA13 antibody (e.g., ab151517 or equivalent) at 4°C overnight

  • Use appropriate secondary antibodies based on the primary antibody host species

• Controls and normalization:

  • Include housekeeping proteins such as GAPDH or Actin for normalization

  • For cell line work, ANXA13 is highly expressed in HCT116 and HT29 colorectal cancer cells, which can serve as positive controls, while SW620, SW48, and Rko cells show lower expression levels

• Expected results: Human ANXA13 should appear as a band at approximately 35.4 kDa, though two isoforms may be detected .

How do experimental models of ANXA13 manipulation affect cellular functions?

Based on the literature, ANXA13 manipulation has demonstrated significant effects on cellular phenotypes:

To implement these models:

• For overexpression, transfect cells with ANXA13-expressing plasmids

• For knockdown, use validated siRNA sequences (as listed in section 1.3)

• Confirm successful manipulation by western blot before proceeding with functional assays

What are the considerations for immunohistochemical detection of ANXA13?

For optimal IHC results with ANXA13 antibodies:

• Tissue preparation:

  • Use formalin-fixed, paraffin-embedded (FFPE) tissue sections

  • Recommended section thickness: 4-6 μm

• Antigen retrieval:

  • Primary recommendation: TE buffer at pH 9.0

  • Alternative: Citrate buffer at pH 6.0

• Antibody dilution and incubation:

  • Recommended dilution range: 1:20-1:200 (optimize for specific antibody and tissue)

  • Incubate with primary antibody overnight at 4°C for best results

• Detection system:

  • Use appropriate detection systems based on the host species of the primary antibody

  • Apply DAB (3,3'-diaminobenzidine) for visualization

• Expected staining pattern:

  • ANXA13 typically shows cytoplasmic and membrane staining

  • Positive control tissue: human small intestine

How can I effectively silence ANXA13 expression in experimental models?

RNA interference (RNAi) has been successfully used to silence ANXA13. Here's a methodological approach:

• siRNA selection: Use validated siRNA sequences targeting ANXA13:

  • ANXA13-homo-I: 5′-GCUGAACAAAGCCUGCAAATT-3′ (sense)
    5′-UUUGCAGGCUUUGUUCAGCTT-3′ (antisense)

  • ANXA13-homo-II: 5′-GCCUCGAAUCAGAUGUCAATT-3′ (sense)
    5′-UUGACAUCUGAUUCGAGGCTT-3′ (antisense)

  • ANXA13-homo-III: 5′-CCUUUCAAGCCUAUCAAAUTT-3′ (sense)
    5′-AUUUGAUAGGCUUGAAAGGTT-3′ (antisense)

• Transfection protocol:

  • Seed cells at 50-70% confluency

  • Use appropriate transfection reagent (Lipofectamine or equivalent)

  • Include non-targeting control: 5′-UUCUCCGAACGUGUCACGUTT-3′ (sense)
    5′-ACGUGACACGUUCGGAGAATT-3′ (antisense)

• Verification of knockdown efficiency:

  • Assess ANXA13 mRNA levels by qRT-PCR (48-72h post-transfection)

  • Confirm protein reduction by western blot (72-96h post-transfection)

  • Consider using fluorescently labeled siRNA to verify transfection efficiency

• Functional assays: After confirming knockdown, proceed with phenotypic assays (proliferation, migration, invasion, etc.) as described in section 2.1.

What are common troubleshooting issues when working with ANXA13 antibodies?

How is ANXA13 currently being used as a biomarker in cancer research?

ANXA13 has emerging applications as a cancer biomarker:

What are the considerations for designing experiments to study ANXA13's role in cell signaling?

When investigating ANXA13's role in cellular signaling pathways:

• Experimental approaches:

  • Genetic manipulation: siRNA knockdown or overexpression systems

  • Protein-protein interaction studies: Co-immunoprecipitation or proximity ligation assays

  • Subcellular localization: Immunofluorescence using validated ANXA13 antibodies

  • Functional assays: Focus on processes relevant to ANXA13's known roles (cell proliferation, migration, apoptosis)

• Key pathways to investigate:

  • Apoptosis pathway: Monitor changes in Bax, Bak, Bcl-2, Caspase-3, and PARP expression after ANXA13 modulation

  • Cell cycle regulation: Assess effects on P21 and Cyclin B1

  • Metastasis-related signaling: Examine MMP2 and MMP9 expression changes

• Experimental controls:

  • Include appropriate positive and negative controls for all experiments

  • Validate findings using multiple cell lines and experimental approaches

  • Consider rescue experiments to confirm specificity of observed effects

• Advanced techniques:

  • RNA-seq or proteomics analysis after ANXA13 modulation to identify global changes in gene or protein expression

  • CRISPR/Cas9-mediated knockout for complete gene ablation studies

  • Patient-derived xenograft models to study ANXA13 function in a more physiologically relevant context