ARHGAP12 Antibody

Introduction to ARHGAP12 Antibody

ARHGAP12 antibodies are immunological reagents designed to specifically bind to and detect Rho GTPase activating protein 12 (ARHGAP12). These antibodies are extensively used in research settings to investigate the expression, localization, and function of ARHGAP12 in various cellular contexts. ARHGAP12 is a GTPase activator for Rho-type GTPases, converting them to an inactive GDP-bound state, thereby regulating multiple cellular processes including cytoskeletal organization, cell adhesion, and migration .

The target antigen, ARHGAP12, is a multidomain protein with significant biological importance. In humans, the canonical protein has a reported length of 846 amino acid residues and a molecular mass of approximately 96.3 kDa . The protein contains several functional domains including an N-terminal Src homology (SH3) domain, a tandem WW (tWW) domain, a pleckstrin homology (PH) domain, and a C-terminal GAP domain . Up to four different isoforms have been identified, with ARHGAP12a and ARHGAP12b being the most well-characterized .

Types of ARHGAP12 Antibodies

ARHGAP12 antibodies are available in various formats, each designed for specific research applications and requirements. These antibodies differ in their production methods, host species, and targeting characteristics.

Polyclonal ARHGAP12 Antibodies

Polyclonal antibodies against ARHGAP12 are produced by immunizing animals with ARHGAP12 protein or peptide fragments. These antibodies recognize multiple epitopes on the ARHGAP12 protein, offering high sensitivity but potentially lower specificity compared to monoclonal alternatives.

Several commercial suppliers offer polyclonal ARHGAP12 antibodies:

• Sigma-Aldrich provides affinity isolated antibodies in buffered aqueous glycerol solution

• Abcam offers rabbit polyclonal antibodies suitable for Western blot applications

• ThermoFisher Scientific supplies polyclonal antibodies that detect endogenous levels of total ARHGAP12

Monoclonal ARHGAP12 Antibodies

Monoclonal antibodies against ARHGAP12 are derived from a single B cell clone, resulting in antibodies that target a specific epitope with high specificity. These antibodies provide consistent results and reduced background.

Examples include:

• Mouse monoclonal antibodies targeting human ARHGAP12 (aa286-452) suitable for Western blot applications

• Mouse monoclonal antibodies with human reactivity available from various suppliers

Classification Based on Host Species

ARHGAP12 antibodies are produced in various host species, with rabbit and mouse being the most common:

• Rabbit-derived ARHGAP12 antibodies: These offer good sensitivity and are suitable for multiple applications. For example, Sigma-Aldrich's HPA000412 is a rabbit polyclonal antibody that has been extensively characterized for immunoblotting and immunohistochemistry applications .

• Mouse-derived ARHGAP12 antibodies: These are typically monoclonal antibodies that provide high specificity for human ARHGAP12. LSBio offers a mouse monoclonal antibody (LS-C794816) targeting human ARHGAP12 .

Immunogen Information

ARHGAP12 antibodies are generated using various immunogens. For example, the Sigma-Aldrich HPA000412 antibody was produced using the immunogen sequence: "RGTQERTWKPPRWTRDASISKGDFQNPGDQELLSSEENYYSTSYSQSDSQCGSPPRGWSEELDERGHTLYTSDYTNEKWLKHVDDQGRQYYYSADGSRSEWELPKYNASSQQQREIIKSRSLDRRLQEPIVLTKWRHSTIVLDTNDKESPTASKPCFPENESSPSSP" .

Abcam's ab241475 antibody was developed using a synthetic peptide corresponding to a region within amino acids 100-150 of human ARHGAP12 .

Species Reactivity

ARHGAP12 antibodies vary in their species reactivity, with many products demonstrating cross-reactivity with multiple species due to conserved epitopes. Common reactivity profiles include:

This cross-reactivity is supported by the conservation of ARHGAP12 across species, with orthologs reported in mouse, rat, bovine, frog, zebrafish, chimpanzee, and chicken .

Recommended Applications

ARHGAP12 antibodies have been validated for various research applications. The table below summarizes the primary applications for selected antibodies:

Validation Methods

Commercial ARHGAP12 antibodies undergo various validation methods to ensure specificity and performance:

• Enhanced validation: Some antibodies, like Sigma-Aldrich's HPA000412, are validated through orthogonal RNA sequencing approaches .

• Western blot validation: Many suppliers validate their antibodies by demonstrating specific band detection at the expected molecular weight (~96 kDa) in various cell lines. For example, Abcam's ab241475 was validated in HeLa, HEK-293T, Jurkat, TCMK-1, and NIH/3T3 cell lysates .

• Immunohistochemistry validation: ARHGAP12 antibodies for IHC applications are typically validated on tissue sections to verify specific staining patterns.

Role in Efferocytosis Studies

ARHGAP12 antibodies have been instrumental in elucidating the dual roles of ARHGAP12 in Stabilin-2 mediated efferocytosis. Research has shown that ARHGAP12 binds to GULP/Stabilin-2 and regulates Rac1 activity during phagocytosis . Specifically, ARHGAP12:

• Switches off Rac1 basal activity

• Spatiotemporally regulates Rac1 to orchestrate phagosome maturation

• Influences the clearance of apoptotic cells

These findings highlight the importance of ARHGAP12 antibodies in visualizing protein localization and interactions during efferocytosis.

Investigation of NK Cell-Mediated Cytotoxicity

Research utilizing ARHGAP12 antibodies has revealed that ARHGAP12 plays a crucial role in natural killer (NK) cell-mediated cytotoxicity. Knockdown of ARHGAP12 in NK cells resulted in diminished cytotoxicity, suggesting its importance in this immune process .

Proteomics studies using ARHGAP12 antibodies have identified that ARHGAP12 interacts with multiple regulators of F-actin dynamics, including:

• WAVE2

• WASP

• Evl

• VASP

Additionally, ARHGAP12 was found to be tyrosine phosphorylated following stimulation through the NKG2D+2B4 activating receptors, indicating its linkage to important signaling pathways in NK cells .

Cancer Research and ARHGAP12 Expression

ARHGAP12 antibodies have been crucial in uncovering the clinical significance of ARHGAP12 in cancer, particularly hepatocellular carcinoma (HCC). A comprehensive study combining single-cell RNA sequencing, bulk RNA data, immunohistochemistry, and proteomics revealed that ARHGAP12 is highly expressed in HCC tissues .

The research demonstrated:

• ARHGAP12 mRNA and protein are upregulated in HCC

• Higher expression is associated with worse prognosis

• ARHGAP12 may trigger tyrosine kinase inhibitor (TKI) resistance through its regulatory role in focal adhesion (FA)

The table below summarizes the findings on ARHGAP12 expression in relation to clinical pathological features:

Immunohistochemistry using ARHGAP12 antibodies showed intense staining in HCC tissues, confirming protein upregulation .

Studies on Epithelial Tight Junctions

Recent research has employed ARHGAP12 antibodies to investigate the role of ARHGAP12 in epithelial tight junctions (TJ). These studies revealed that ARHGAP12 suppresses F-actin assembly to control epithelial tight junction leak pathway permeability .

Key findings include:

• ARHGAP12 is recruited to tight junctions via an interaction between its SH3 domain and the TJ protein ZO-2

• The tandem WW domain of ARHGAP12 interacts directly with N-WASP to suppress actin polymerization

• CRISPR/Cas9-mediated inactivation of ARHGAP12 in MDCK-II cells delays TJ formation and increases junctional tension

This research has significant implications for understanding epithelial barrier function and regulation of macromolecular transport across tight junctions .

G-actin Regulation Studies

ARHGAP12 antibodies have been used to study the relationship between ARHGAP12 and G-actin. Research has shown that ARHGAP12 belongs to the RPEL family of RhoGAPs and links Rac/Cdc42 GTP loading to G-actin availability .

Studies using co-immunoprecipitation with ARHGAP12 antibodies have demonstrated that:

• Actin is readily detectable in ARHGAP12 immunoprecipitates

• Actin recovery decreases following serum stimulation

• G-actin inhibits ARHGAP12 GAP activity

• ARHGAP12 suppresses basal Rac and Cdc42 activity, F-actin assembly, and invadopodia formation

These findings highlight the role of ARHGAP12 in coordinating cytoskeletal processes with actin dynamics .

Major Suppliers of ARHGAP12 Antibodies

ARHGAP12 antibodies are available from numerous commercial suppliers, each offering products with various specifications:

This diverse selection allows researchers to choose antibodies based on specific experimental needs.

Guidelines for Antibody Selection

When selecting ARHGAP12 antibodies for research, consider the following factors:

1. Target application: Select antibodies validated for your specific application (WB, IHC, ELISA, etc.)

2. Species reactivity: Ensure the antibody recognizes ARHGAP12 from your species of interest

3. Format: Choose between polyclonal (higher sensitivity) and monoclonal (higher specificity) based on research needs

4. Validation data: Review available validation data including Western blot images, IHC staining patterns, and specificity tests

5. Epitope information: Consider the epitope location when studying specific domains or isoforms of ARHGAP12

Potential as Biomarkers

Recent research on ARHGAP12 expression in HCC suggests potential applications of ARHGAP12 antibodies in cancer diagnostics and prognostics. The correlation between high ARHGAP12 expression and poor prognosis indicates its value as a prognostic biomarker .

Additionally, the link between ARHGAP12 and TKI resistance suggests that ARHGAP12 detection could aid in predicting treatment response, particularly for targeted therapies in cancer patients.

Therapeutic Implications

The identification of ARHGAP12's role in multiple cellular processes, including tight junction regulation, NK cell cytotoxicity, and cancer progression, highlights potential therapeutic applications. ARHGAP12 antibodies could serve as valuable tools in:

• Developing targeted therapies against ARHGAP12

• Monitoring treatment response

• Understanding resistance mechanisms to existing therapies

Technological Advancements

Ongoing improvements in antibody technology may enhance the utility of ARHGAP12 antibodies:

• Development of recombinant antibodies with improved specificity

• Creation of antibodies targeting specific phosphorylated states of ARHGAP12

• Generation of isoform-specific antibodies to distinguish between ARHGAP12 variants