aste1 Antibody

Shipped with Ice Packs
In Stock

Description

Introduction to ASTE1 Antibody

ASTE1 (asteroid homolog 1) antibody is a polyclonal immunoglobulin G (IgG) reagent designed to detect the ASTE1 protein, which plays roles in DNA repair, immune regulation, and cancer biology. This antibody is widely used in molecular and cellular research to investigate ASTE1 expression, localization, and functional interactions in human tissues and disease models .

Validation and Specificity

ASTE1 antibodies are rigorously validated for specificity and reproducibility. Key validation data include:

Validation MethodDetails
Orthogonal ValidationConfirmed via Western blot (WB), immunocytochemistry (ICC), and immunohistochemistry (IHC) .
Species ReactivityHuman (validated), rat (predicted 90% homology) .
Immunogen SequenceRecombinant peptide: CFVQCFSEADRDIMTLANHWNCPVLSSDSDFCIFDLKTGFCPLNSFQWRNMNTIKGTQNYIPAKCFSLDAFCHHFSNMNKALLPLFAVLCGNDHVNLPIME .

The antibody shows no cross-reactivity with unrelated proteins in control assays .

Research Applications

ASTE1 antibodies are employed in diverse experimental workflows:

ApplicationRecommended Usage
Western Blot (WB)0.04–0.4 µg/ml in cell lysates .
Immunohistochemistry (IHC)1:500–1:1000 dilution; HIER pH 6 retrieval .
Immunofluorescence (IF)0.25–2 µg/ml; PFA/Triton X-100 fixation .

In cancer research, ASTE1 antibodies have been used to study frameshift mutations (e.g., R632Gfs*33) in Epstein-Barr virus-associated gastric cancer (EBVaGC), where ASTE1 loss correlates with enhanced interferon-γ (IFN-γ) responses and PD-L1 upregulation .

Key Research Findings

Recent studies utilizing ASTE1 antibodies highlight its role in immune regulation and cancer:

  • Immune-Active Tumors: ASTE1 frameshift mutations in EBVaGC were linked to increased IFN-γ signaling, PD-L1 expression, and T-cell infiltration, as confirmed by IHC and WB .

  • Mechanistic Insights: Knockout models showed ASTE1 mutations activate the NF-κB pathway, promoting chemokine (CXCL9/10/11) secretion and immune cell recruitment .

  • Therapeutic Relevance: ASTE1-mutant cancers exhibit sensitivity to PD-1 inhibitors, suggesting predictive utility for immunotherapy .

Limitations and Considerations

  • Research Use Only: Not approved for clinical diagnostics .

  • Cell Line Variability: Subcellular localization (e.g., endoplasmic reticulum in U-2 OS cells) may differ across models .

  • Batch-Specific Variations: Antibody concentrations vary by lot; users must verify vial labels .

Future Directions

Ongoing studies aim to clarify ASTE1’s role in DNA repair pathways and its interplay with complexes like shieldin-CST in homologous recombination . Further validation in BRCA1-mutant models could expand its relevance in precision oncology.

Product Specs

Buffer
Preservative: 0.03% Proclin 300
Constituents: 50% Glycerol, 0.01M Phosphate Buffered Saline (PBS), pH 7.4
Form
Liquid
Lead Time
Made-to-order (14-16 weeks)
Synonyms
aste1 antibody; si:dkey-11p23.5Protein asteroid homolog 1 antibody
Target Names
aste1
Uniprot No.

Target Background

Function
This antibody may play a role in epidermal growth factor receptor (EGFR) signaling.
Database Links

KEGG: dre:100006826

UniGene: Dr.82089

Protein Families
Asteroid family

Q&A

What is ASTE1 and why is it important in DNA repair research?

ASTE1 (Asteroid Homolog 1) functions as a structure-specific DNA endonuclease that specifically cleaves single-stranded DNA and 3' overhang DNA. It plays a crucial role as a downstream effector of the shieldin complex, localizing to DNA damage sites in a shieldin-dependent manner. ASTE1's importance stems from its involvement in DNA double-strand break repair pathways, specifically in promoting non-homologous end-joining (NHEJ). Loss of ASTE1 has been shown to impair NHEJ, lead to hyper-resection and cause defective immunoglobulin class switch recombination . Additionally, ASTE1 deficiency causes resistance to poly(ADP-ribose) polymerase (PARP) inhibitors in BRCA1-deficient cells by restoring homologous recombination (HR) . This makes ASTE1 particularly relevant for cancer research, especially studies involving BRCA1-deficient tumors and PARP inhibitor resistance mechanisms.

What applications are ASTE1 antibodies validated for in laboratory research?

ASTE1 antibodies are validated for multiple applications in molecular and cellular biology research:

ApplicationRecommended DilutionNotes
Western Blot (WB)0.04-0.4 μg/mlPrimary method for protein detection
Immunohistochemistry (IHC)1:50 - 1:200For tissue sections
Immunohistochemistry-Paraffin (IHC-P)1:500 - 1:1000For formalin-fixed paraffin-embedded samples
Immunocytochemistry/Immunofluorescence (ICC/IF)0.25-2 μg/mlFor cellular localization studies

For optimal results in IHC-Paraffin applications, heat-induced epitope retrieval (HIER) at pH 6 is recommended . For ICC/IF applications, paraformaldehyde fixation with Triton X-100 permeabilization provides optimal results .

What are the storage and handling recommendations for ASTE1 antibodies?

For optimal antibody performance and longevity, follow these evidence-based storage and handling protocols:

  • Short-term storage (up to 1 month): Store at 4°C

  • Long-term storage: Aliquot and store at -20°C

  • Avoid repeated freeze-thaw cycles as this can denature the antibody and reduce activity

  • Most commercial ASTE1 antibodies are supplied in PBS (pH 7.2) with 40% glycerol and 0.02% sodium azide as preservative

  • When working with the antibody, maintain cold chain integrity and use sterile technique to prevent contamination

  • Record lot numbers and validate each new lot against previous results to ensure consistency

How do I determine the appropriate ASTE1 antibody for my specific research model?

Selection of an appropriate ASTE1 antibody should be based on several critical factors:

  • Species reactivity: Verify that the antibody recognizes ASTE1 in your model organism. Commercial ASTE1 antibodies have varying reactivity profiles:

    • Human-specific

    • Human and mouse cross-reactive

    • Human, mouse, and rat cross-reactive

  • Epitope targeting: Consider which region of ASTE1 is most relevant to your research:

    • N-terminal specific antibodies (e.g., AA 29-55)

    • Full-length protein antibodies

    • Domain-specific antibodies for particular functional studies

  • Antibody format:

    • Unconjugated for maximum flexibility in detection methods

    • Conjugated versions (biotin, fluorescent labels) for direct detection

  • Clonality:

    • Polyclonal antibodies for higher sensitivity but potentially more background

    • Monoclonal antibodies for higher specificity and reproducibility

  • Validated applications: Ensure the antibody is validated for your specific application through published literature, manufacturer data, or preliminary testing .

How can I optimize detection of ASTE1 at DNA damage sites using immunofluorescence?

Detecting ASTE1 at DNA damage sites requires careful optimization of the immunofluorescence protocol:

  • Cell preparation:

    • Grow cells on glass coverslips coated with poly-L-lysine for improved adherence

    • Induce DNA damage using controlled methods such as laser micro-irradiation, I-PpoI or I-SceI endonuclease expression, or chemical agents (camptothecin, etoposide)

  • Fixation and permeabilization:

    • Use 4% paraformaldehyde (10-15 minutes at room temperature) for fixation

    • Permeabilize with 0.2% Triton X-100 (5-10 minutes)

    • Alternative: Methanol fixation (-20°C for 10 minutes) for certain epitopes

  • Blocking and antibody incubation:

    • Block with 3-5% BSA in PBS for at least 1 hour

    • Incubate with ASTE1 primary antibody (0.25-2 μg/ml) overnight at 4°C

    • Use γH2AX antibody as a co-marker for DNA damage sites

    • Include appropriate fluorescently-labeled secondary antibodies

  • Visualization optimization:

    • Use confocal microscopy for superior resolution of nuclear foci

    • Consider super-resolution techniques (STED, STORM) for detailed co-localization studies

    • For time-course studies of ASTE1 recruitment, fix cells at various timepoints after damage induction

    • Include DAPI staining for nuclear visualization

For advanced studies, consider using ASTE1 antibodies directly conjugated to fluorophores (AbBy Fluor® 488, 555, 594, 647, or 680) to reduce background and enable multi-color imaging with other DNA repair proteins .

What controls should be included when studying ASTE1 in the context of DNA repair pathways?

Comprehensive controls are essential for rigorous ASTE1 research in DNA repair contexts:

How can I investigate the interaction between ASTE1 and the Shieldin complex in DNA repair?

To comprehensively study ASTE1-Shieldin interactions, employ these methodological approaches:

  • Co-immunoprecipitation (Co-IP) assays:

    • Immunoprecipitate ASTE1 and probe for Shieldin components (SHLD1, SHLD2, SHLD3, REV7)

    • Perform reciprocal IP with antibodies against Shieldin components

    • Use nuclease treatment to determine if interactions are DNA-dependent

    • Include 53BP1 and RIF1 antibodies to examine upstream regulators

  • Proximity ligation assay (PLA):

    • Visualize direct protein-protein interactions between ASTE1 and Shieldin components in situ

    • Quantify interaction signals before and after DNA damage induction

    • Compare interaction frequency at different timepoints after damage

  • Sequential ChIP (ChIP-re-ChIP):

    • First immunoprecipitate with ASTE1 antibody, then with antibodies against Shieldin components

    • Map co-occupancy at DNA damage sites

    • Compare binding profiles before and after DNA damage

  • Recruitment kinetics analysis:

    • Use live-cell imaging with fluorescently-tagged proteins

    • Compare recruitment timing of ASTE1 versus Shieldin components

    • Analyze dependency by depleting individual components and measuring effects on recruitment

  • Domain mapping:

    • Generate truncation mutants of ASTE1 to identify regions required for Shieldin interaction

    • Test S1-like domain deletion mutants similar to those used for CCAR2-Shieldin interactions

    • Use yeast two-hybrid or mammalian two-hybrid systems to validate direct interactions

These approaches should be accompanied by functional assays (NHEJ/HR reporter assays, PARP inhibitor sensitivity tests) to correlate physical interactions with biological functions.

How do I interpret discrepancies in ASTE1 antibody staining patterns across different research models?

When encountering inconsistent ASTE1 staining patterns, consider these methodological approaches to resolve discrepancies:

  • Species-specific variations:

    • Human ASTE1 genomically overlaps with ATP2C1, while mouse ASTE1 does not

    • This structural difference may affect expression patterns, alternative splicing, and antibody recognition

    • Verify antibody epitope conservation across species using sequence alignment tools

    • Consider using species-specific antibodies validated for your model organism

  • Alternative splicing and isoform detection:

    • Human ASTE1's genomic organization may result in alternative transcripts

    • Use RT-PCR to determine which ASTE1 isoforms are expressed in your model

    • Verify if your antibody recognizes all relevant ASTE1 isoforms

    • Consider using antibodies targeting different epitopes to capture all isoforms

  • Technical optimization approaches:

    • Compare multiple fixation methods (paraformaldehyde, methanol, acetone)

    • Test different antigen retrieval techniques for IHC/ICC (heat-induced at various pH levels, enzymatic)

    • Optimize antibody concentration through titration experiments

    • Test different blocking reagents to reduce background (BSA, normal serum, commercial blockers)

  • Biological verification strategies:

    • Use ASTE1 siRNA/shRNA knockdown or CRISPR knockout cells as negative controls

    • Employ multiple antibodies targeting different ASTE1 epitopes

    • Validate subcellular localization using cellular fractionation followed by Western blot

    • Consider expression levels in different cell types and conditions (e.g., after DNA damage)

  • Data integration approach:

    • Create a comparative table of staining patterns across models, fixation methods, and antibodies

    • Correlate immunostaining results with other detection methods (Western blot, MS)

    • Evaluate consistency with reported functional interactions (e.g., Shieldin colocalization)

What are the methodological considerations for studying ASTE1's endonuclease activity in DNA repair?

To effectively characterize ASTE1's endonuclease function, employ these specialized approaches:

  • In vitro nuclease assays:

    • Purify recombinant ASTE1 protein (consider using the same immunogen sequence used for antibody production, AA 29-55)

    • Test activity on various DNA substrates:

      • Single-stranded DNA oligonucleotides

      • 3' overhang structures

      • Various DNA secondary structures

    • Monitor cleavage products using gel electrophoresis

    • Include control nucleases with known specificity patterns

  • Cell-based functional assays:

    • Generate catalytically inactive ASTE1 mutants (identify and mutate catalytic residues)

    • Compare DNA repair outcomes in cells expressing wild-type vs. mutant ASTE1

    • Measure NHEJ efficiency using reporter assays in the presence/absence of ASTE1

    • Analyze resection extent using single-molecule analysis of resection tracks (SMART) assay

  • Structure-function analysis:

    • Map the endonuclease domain of ASTE1 using deletion constructs

    • Generate point mutations in putative catalytic residues

    • Correlate structural features with enzymatic activity

    • Use structure prediction tools to model ASTE1's catalytic site

  • Substrate specificity determination:

    • Test ASTE1 activity on various DNA structures mimicking repair intermediates

    • Analyze sequence preferences at cleavage sites

    • Determine length requirements for efficient substrate recognition

    • Investigate the effect of DNA modifications (phosphorylation, methylation) on activity

  • In vivo DNA end processing analysis:

    • Use ChIP-seq with ASTE1 antibodies to map binding sites at breaks

    • Employ high-throughput sequencing of repair junctions to identify ASTE1-dependent signature

    • Compare DNA end structures in ASTE1-proficient vs. ASTE1-deficient cells

    • Analyze interaction with other end-processing factors (MRE11, EXO1, DNA2)

How can the relationship between ASTE1 and PARP inhibitor resistance be investigated experimentally?

To systematically investigate ASTE1's role in PARP inhibitor resistance, implement this experimental framework:

  • Cellular model systems:

    • Generate isogenic cell lines with various genetic backgrounds:

      • BRCA1-proficient/ASTE1-proficient

      • BRCA1-deficient/ASTE1-proficient

      • BRCA1-proficient/ASTE1-deficient

      • BRCA1-deficient/ASTE1-deficient

    • Use multiple cell types relevant to cancer research (breast, ovarian epithelial cells)

    • Employ CRISPR/Cas9 for gene knockout and complementation with wild-type/mutant constructs

  • PARP inhibitor sensitivity assays:

    • Perform dose-response curves with multiple PARP inhibitors (olaparib, talazoparib, niraparib)

    • Measure short-term viability (MTT/CellTiter-Glo) and long-term survival (colony formation)

    • Analyze IC50 values and resistance factors across genotypes

    • Include combination treatments with DNA-damaging agents (cisplatin, mitomycin C)

  • Molecular mechanism investigation:

    • Analyze HR restoration using RAD51 foci formation assays

    • Measure DNA end resection using RPA foci or BrdU staining under non-denaturing conditions

    • Assess NHEJ activity using specific reporter constructs (EJ5-GFP)

    • Monitor 53BP1-Shieldin-ASTE1 pathway integrity through immunofluorescence co-localization

  • Comprehensive dataset generation:

    Cell LineBRCA1 StatusASTE1 StatusOlaparib IC50RAD51 FociRPA FociNHEJ Activity
    ParentalProficientProficient
    BRCA1-KODeficientProficient
    ASTE1-KOProficientDeficient
    Double-KODeficientDeficient
  • Clinical correlation studies:

    • Analyze ASTE1 expression in patient-derived xenografts or organoids

    • Correlate ASTE1 levels with PARP inhibitor response in patient samples

    • Examine ASTE1 mutations/expression in tumors with acquired PARP inhibitor resistance

    • Develop ASTE1 immunohistochemistry scoring system for potential clinical application

This methodological framework provides a comprehensive approach to understanding ASTE1's role in PARP inhibitor resistance mechanisms, with potential translational implications for cancer therapy.

What are the most common causes of inconsistent Western blot results with ASTE1 antibodies?

When troubleshooting inconsistent Western blot results with ASTE1 antibodies, consider these methodological solutions:

  • Protein extraction optimization:

    • Use appropriate lysis buffers containing protease inhibitors to prevent degradation

    • Consider subcellular fractionation as ASTE1 may localize to nuclear compartments

    • Include phosphatase inhibitors if studying DNA damage-induced modifications

    • Validate extraction efficiency using known nuclear and cytoplasmic markers

  • Sample preparation refinements:

    • Avoid excessive heating of samples (limit to 5 minutes at 95°C)

    • Use fresh DTT or β-mercaptoethanol in loading buffer

    • Optimize protein loading amount (10-30 μg for cell lysates)

    • Consider using gradient gels (4-12%) for better resolution

  • Transfer and detection optimization:

    • For ASTE1 detection, use PVDF membranes for better protein retention

    • Optimize transfer conditions based on protein size (154 kDa for full-length)

    • Titrate primary antibody concentration (recommended: 0.04-0.4 μg/ml)

    • Extend primary antibody incubation time (overnight at 4°C)

    • Test different blocking reagents (5% milk, 5% BSA, commercial blockers)

  • Specificity verification:

    • Include positive controls (cell lines with known ASTE1 expression)

    • Include negative controls (ASTE1 knockdown/knockout samples)

    • Test multiple ASTE1 antibodies targeting different epitopes

    • Consider using ASTE1 overexpression lysate as a positive control

  • Systematic troubleshooting approach:

    IssuePotential CauseSolution
    No signalInsufficient antibody concentrationIncrease antibody concentration to 0.4 μg/ml
    Multiple bandsCross-reactivity or degradationVerify with knockout controls, use fresher samples with protease inhibitors
    Inconsistent resultsVariable exposure to DNA damageStandardize cell treatment conditions, synchronize cells
    High backgroundInadequate blocking/washingOptimize blocking, increase washing time/detergent concentration
    Weak signalLow ASTE1 expressionEnrich nuclear fraction, induce DNA damage to upregulate expression

How can I validate the specificity of ASTE1 antibodies for my research applications?

Rigorous validation of ASTE1 antibody specificity requires a multi-faceted approach:

  • Genetic validation strategies:

    • Generate ASTE1 knockout cells using CRISPR/Cas9

    • Perform ASTE1 knockdown using siRNA or shRNA

    • Compare signal between wild-type and ASTE1-depleted samples across applications

    • Rescue experiments by re-expressing ASTE1 in knockout cells

  • Overexpression validation:

    • Transfect cells with tagged ASTE1 constructs (e.g., FLAG, GFP)

    • Compare antibody staining with tag-specific antibodies

    • Test correlation between expression level and antibody signal

    • Use vector-only transfected controls for background assessment

  • Cross-platform verification:

    • Compare results across multiple applications (WB, IHC, ICC/IF)

    • Verify subcellular localization consistency between methods

    • Correlate protein levels detected by Western blot with immunostaining intensity

    • Verify expression patterns with mRNA data (RT-PCR, RNA-seq)

  • Multiple antibody comparison:

    • Test antibodies targeting different ASTE1 epitopes:

      • N-terminal region (AA 29-55)

      • C-terminal regions

      • Internal domains

    • Compare monoclonal and polyclonal antibodies

    • Evaluate consistency of staining patterns across antibodies

  • Advanced validation techniques:

    • Peptide competition assays using the immunizing peptide

    • Mass spectrometry verification of immunoprecipitated proteins

    • Epitope mapping through deletion constructs

    • Cross-species reactivity testing if working with multiple models

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.