etnppl Antibody

Shipped with Ice Packs
In Stock

Description

ETNPPL Antibody Overview

ETNPPL antibodies are immunological reagents targeting the ETNPPL protein, which catalyzes the pyridoxal-phosphate-dependent breakdown of phosphoethanolamine into ammonia, inorganic phosphate, and acetaldehyde . These antibodies are critical for studying astrocyte biology, particularly in adult brains and spinal cords . Two primary types exist:

  • Monoclonal antibodies (e.g., clones 63B2, 50A2, 94A3): Developed using recombinant mouse ETNPPL, validated for specificity in Western blot (WB), immunohistochemistry (IHC), and immunoprecipitation (IP) .

  • Polyclonal antibodies (e.g., PA5-60741): Target human ETNPPL isoform 1, with immunogen sequence VLKIKPPMCFTEEDAKFMVDQLDRILTVLEEAMGTKTESVTSENTPCKTKMLKEAHIELLRDSTTDSKENPSRK .

Key Steps in Antibody Production

  1. Antigen Preparation: His-tagged recombinant mouse ETNPPL was expressed and purified for monoclonal antibody development .

  2. Hybridoma Screening: 95 clones were screened, yielding three specific clones (63B2, 50A2, 94A3) for WB, IHC, or IP .

  3. Knockout Validation: Antibody specificity was confirmed using Etnppl-knockout mice, showing no cross-reactivity .

Validation Results

Antibody CloneApplicationsSpecificity Confirmed By
63B2IHC, WBKnockout mice, IHC signal loss in Etnppl–/– tissues
50A2IP, WBImmunoprecipitation efficiency (10–20%)
94A3WBSingle band at ~50 kDa in WB

Astrocyte-Specific Labeling

  • ETNPPL antibodies selectively label astrocytes in adult mice, with minimal expression in neurons, microglia, or oligodendrocytes .

  • Subcellular Localization: Dominant nuclear expression in astrocytes, with weak cytosolic signals in a subset .

Pathological Models

ETNPPL expression changes in:

  • Spinal Cord Injury: Downregulation correlates with axonal sprouting post-pyramidotomy .

  • Stroke and Inflammation: Differential expression in RNA-seq datasets .

Developmental Changes

AgeETNPPL Expression LevelKey Regions
Neonatal (P4)Very weakVentricular/subventricular zones
2 WeeksWeakOlfactory bulb, medulla
8 WeeksHeterogeneous (highest in cerebellum, olfactory bulb, hypothalamus)

Regional Expression in Adult Mice

Brain RegionExpression LevelNotes
CerebellumHighNuclear-dominant localization
White MatterLowMinimal astrocyte labeling
Spinal CordModerateSubset of Gjb6+ astrocytes

Comparative Analysis with Other Astrocyte Markers

MarkerSpecificityOverlap with ETNPPL+ CellsUtility in Pathological Models
Gjb6Broad astrocyte populationETNPPL+ cells are a subset Limited to developmental stages
Aldh1l1General astrocyte markerPartial overlapLess sensitive to injury
AgtReactive astrocytesIndependent of ETNPPL Focuses on inflammation

Future Directions

  • Mechanistic Studies: Role of ETNPPL in phosphoethanolamine metabolism and astrocyte maturation.

  • Therapeutic Potential: Targeting ETNPPL+ astrocytes in neuroregeneration or neuroinhibition.

Product Specs

Buffer
Preservative: 0.03% Proclin 300
Constituents: 50% Glycerol, 0.01M Phosphate Buffered Saline (PBS), pH 7.4
Form
Liquid
Lead Time
Made-to-order (14-16 weeks)
Synonyms
etnppl antibody; agxt2l1 antibody; zgc:63486Ethanolamine-phosphate phospho-lyase antibody; EC 4.2.3.2 antibody; Alanine--glyoxylate aminotransferase 2-like 1 antibody
Target Names
etnppl
Uniprot No.

Target Background

Function
This antibody catalyzes the breakdown of phosphoethanolamine in a reaction dependent on pyridoxal phosphate. The breakdown process converts phosphoethanolamine into ammonia, inorganic phosphate, and acetaldehyde.
Database Links
Protein Families
Class-III pyridoxal-phosphate-dependent aminotransferase family
Subcellular Location
Mitochondrion.

Q&A

What is ETNPPL and why is it significant as a research target?

ETNPPL (Ethanolamine phosphate phospholyase), also known as AGXT2L1 (Alanine--glyoxylate aminotransferase 2-like 1), is a lipid metabolizing enzyme involved in phosphoethanolamine metabolism in cell membranes . Its significance stems from several key characteristics:

  • Selectively expressed in astrocytes in adult central nervous system

  • Expression patterns change during development (minimal in neonates, increases with age)

  • Shows heterogeneous distribution in the adult brain with highest expression in cerebellum, olfactory bulb, and hypothalamus

  • Nuclear-dominant subcellular localization with weak cytosolic expression in some populations

  • Expression changes in response to various pathological conditions including spinal cord injury, stroke, and inflammation

These characteristics make ETNPPL a valuable marker for mature astrocytes and a potential target for understanding CNS development and pathology.

What types of ETNPPL antibodies are available for research?

Current research utilizes both monoclonal and polyclonal antibodies against ETNPPL:

Antibody TypeHost SpeciesApplicationsAdvantages
Monoclonal (e.g., clones 50A2, 63B2, 94A3)RatWB, IHC, IPHigh specificity, validated with knockout mice, clone-specific application strengths
PolyclonalRabbitWB, ELISA, IHCBroader epitope recognition, versatility across applications

When selecting an antibody, researchers should consider the specific experimental application, as different clones demonstrate varying efficacy. For example, clone 63B2 exhibits stronger signals in IHC, while clone 94A3 performs better in Western blotting .

How is ETNPPL expression distributed across different tissues and developmental stages?

ETNPPL shows distinct expression patterns that vary by:

Developmental stage:

  • Minimal expression in neonatal mice (P4), except in ventricular and subventricular zones

  • Weak but detectable expression at 2 weeks in select brain regions

  • Robust and heterogeneous expression by 8 weeks (adult)

Regional distribution in adult:

  • Highest expression: Cerebellum, olfactory bulb, hypothalamus

  • Moderate expression: Lateral septal nucleus, ventricular zone, pontine, medulla, midbrain, cerebral cortex, hippocampus, thalamus, spinal cord

  • Lowest expression: White matter

Tissue specificity:

  • Predominantly expressed in liver, brain, salivary glands, kidney, and stomach tissues

  • Within neural tissue, selectively expressed in astrocytes, not in neurons, microglia, oligodendrocytes, OPCs, or pericytes

This spatiotemporal expression pattern makes ETNPPL particularly valuable for studying mature astrocyte functions and regional specialization in the CNS.

What are the optimal protocols for using ETNPPL antibodies in immunohistochemistry?

Based on published methodologies, the following protocol has been validated for ETNPPL detection in tissue sections:

Tissue preparation:

  • Fix tissues using standard paraformaldehyde fixation

  • Process and embed in paraffin or prepare frozen sections

  • For paraffin sections: deparaffinize and rehydrate tissues prior to staining

Antigen retrieval:

  • Perform heat-induced epitope retrieval (HIER) using commercial kits (e.g., EnVision FLEX Mini Kit, High pH)

  • This step is crucial for restoring antigen tertiary structure after fixation

Antibody incubation:

  • For monoclonal antibodies (e.g., clone 63B2): Optimal dilution determined empirically, typically around 1:100-1:200

  • For polyclonal antibodies: Recommended dilution 1:200 (commercial anti-AGXT2L1/ETNPPL)

  • Incubate for approximately 2 hours at room temperature

Detection and visualization:

  • Use appropriate secondary antibodies conjugated to biotin or fluorophores

  • For DAB detection, follow standard protocols with proper blocking of endogenous peroxidases

  • For fluorescence, use specific anti-host species secondary antibodies

Controls:

  • Negative controls: Use ETNPPL knockout tissue when available or omit primary antibody

  • Positive controls: Adult cerebellum or astrocyte-rich regions show reliable ETNPPL expression

This methodology has been demonstrated to produce specific labeling of ETNPPL-expressing cells, predominantly astrocytes in adult CNS tissue.

How should researchers validate the specificity of ETNPPL antibodies?

Rigorous validation of ETNPPL antibodies is essential before interpretation of experimental results. Based on published approaches, a comprehensive validation strategy includes:

Genetic validation:

  • Test antibodies on tissues from ETNPPL knockout animals (gold standard)

  • Compare heterozygous (+/-) with homozygous (-/-) samples to assess dose-dependence of signal

Biochemical validation:

  • Western blotting: Confirm single band of appropriate molecular weight (~50-55 kDa)

  • Immunoprecipitation followed by mass spectrometry to confirm target identity

Expression pattern validation:

  • Compare antibody labeling with known mRNA expression patterns from in situ hybridization or RNA-seq data

  • Confirm cell-type specificity through co-labeling with established cell-type markers

Cross-platform validation:

  • Compare results across multiple techniques (WB, IHC, IP) to ensure consistency

  • Test multiple antibody clones or lots when available

In published studies, high-quality anti-ETNPPL monoclonal antibodies demonstrated consistency across all validation methods, with a single band at the expected molecular weight in Western blot and selective labeling of astrocytes in immunohistochemistry, confirmed by the absence of signal in knockout tissue .

What are the recommended approaches for quantifying ETNPPL expression in tissue samples?

For accurate quantification of ETNPPL expression, researchers should consider these methodological approaches:

mRNA quantification:

  • qRT-PCR using validated primers (e.g., Hs00229818_m1 for human ETNPPL)

  • Reference gene normalization (GAPDH commonly used, assay Hs99999905_m1)

  • Relative quantification using the ΔΔCt method for comparison between experimental and control groups

Protein quantification by Western blot:

  • Total protein normalization using Stain-free technology rather than single housekeeping proteins

  • Densitometric analysis with appropriate software

  • Dilution series to ensure measurements within linear range

Immunohistochemical quantification:

  • Cell counting: Determine percentage of ETNPPL-positive cells among total cells or specific cell populations

  • Fluorescence intensity measurement for semi-quantitative analysis

  • Stereological approaches for unbiased quantification in three-dimensional tissue

RNA-sequencing analysis:

  • Bulk RNA-seq for tissue-level expression changes

  • Single-cell RNA-seq for cellular heterogeneity and subset analysis

  • Pseudobulk analysis of scRNA-seq data to quantify cell-type specific changes

When analyzing pathological conditions, comparison between affected and control tissues using consistent methodology is essential, as ETNPPL expression can vary depending on the type of injury or disease process .

How should researchers design experiments to investigate ETNPPL expression changes in disease models?

Based on published approaches, an optimal experimental design to study ETNPPL in disease models includes:

Model selection considerations:

  • Acute vs. chronic models: ETNPPL shows different temporal responses depending on injury type

  • Region-specific effects: Consider heterogeneous baseline expression in different brain regions

  • Age considerations: Account for developmental changes in ETNPPL expression

Sampling timepoints:

  • Include early timepoints (2-3 days post-injury) when expression changes are most pronounced

  • Consider multiple timepoints to capture dynamic changes (e.g., 2 days, 7 days, 14 days, 28 days)

Control considerations:

  • Age-matched controls are essential due to age-dependent expression patterns

  • Sex-matched controls, as sex differences in ETNPPL expression have been observed

  • Sham procedures to control for surgical effects in injury models

Multi-method approach:

  • Combine RNA analysis (qRT-PCR, RNA-seq) with protein detection (WB, IHC)

  • Include spatial analysis (IHC, ISH) to identify regional and cellular heterogeneity

  • Consider subcellular localization changes with high-resolution imaging

Data collection and analysis:

  • Quantify both percentage of positive cells and intensity of expression

  • Correlate ETNPPL changes with functional outcomes or other molecular markers

  • Use appropriate statistical methods for multiple comparisons

Studies have shown that ETNPPL expression decreases after spinal cord injury, ischemic stroke, and AAV vector infection, but increases following hemorrhagic stroke or LPS administration, highlighting the importance of model selection and temporal sampling .

What are the key considerations when using ETNPPL as an astrocyte marker?

When using ETNPPL as an astrocyte marker, researchers should consider several important factors:

Advantages of ETNPPL as an astrocyte marker:

  • Selective expression in astrocytes in adult CNS

  • Different expression pattern than traditional markers like GFAP

  • May identify mature astrocyte populations not captured by other markers

Important limitations:

  • Heterogeneous expression across brain regions

  • Developmental regulation (minimal in neonates)

  • Expression in only a subset of Gjb6+ astrocytes

  • Dynamic expression changes in pathological conditions that differ from GFAP

Recommended co-labeling approaches:

  • Combine with traditional astrocyte markers (GFAP, S100β, ALDH1L1)

  • Use with Gjb6 (connexin 30) to identify ETNPPL-expressing subpopulations

  • Include nuclear markers (e.g., SOX9) to identify all astrocytes regardless of activation state

Quantification approaches:

  • Report percentage of ETNPPL+ cells among total astrocytes

  • Quantify regional variations in expression

  • Consider subcellular localization (predominantly nuclear)

Studies have demonstrated that ETNPPL expression patterns differ from GFAP in response to pathological conditions. While GFAP is consistently upregulated in reactive astrocytes, ETNPPL shows variable responses depending on the insult type, suggesting it may reflect different aspects of astrocyte biology .

How can researchers differentiate between ETNPPL expression changes due to development versus pathology?

Distinguishing developmental from pathological changes in ETNPPL expression requires careful experimental design:

Baseline developmental characterization:

  • Age-matched controls at multiple developmental timepoints (P4, 2W, 8W, 18M)

  • Regional analysis to account for heterogeneous developmental trajectories

  • Sex-stratified analysis due to observed sex differences in expression

Methodological approaches:

  • Compare absolute expression levels using calibrated qRT-PCR or RNA-seq

  • Analyze cell-type specificity using single-cell approaches to detect population shifts

  • Examine subcellular localization changes that may indicate functional differences

Key differentiating features:

  • Developmental changes: Gradual increase across most brain regions from neonatal to adult stages

  • Pathological changes: Often show acute, region-specific alterations with potential recovery over time

  • Cell population changes: Pathology may affect specific astrocyte subpopulations differently

Statistical considerations:

  • Use two-way ANOVA to assess interaction between age and pathological condition

  • Implement linear mixed models for longitudinal studies with repeated measures

  • Consider normalization strategies that account for developmental baseline differences

Research has shown that while ETNPPL expression increases during normal development, pathological conditions can either increase or decrease expression depending on the type and severity of insult, with some changes being transient (normalizing by 2 weeks post-injury) and others more persistent .

How does ETNPPL expression correlate with functional changes in astrocytes during pathological conditions?

The relationship between ETNPPL expression and astrocyte functional states represents an advanced research question:

Current evidence of functional correlations:

  • Downregulation after spinal cord injury correlates with periods of axonal sprouting, suggesting a negative relationship with axonal elongation

  • Different responses in hemorrhagic versus ischemic stroke indicate distinct astrocyte functional states

  • Post-pyramidotomy decreases that recover by 2 weeks suggest transient functional changes

Methodological approaches to investigate functional correlations:

  • Combine ETNPPL immunostaining with markers of astrocyte reactivity (GFAP, vimentin)

  • Assess morphological changes in ETNPPL+ versus ETNPPL- astrocytes

  • Correlate with functional readouts such as glutamate uptake, cytokine production, or BBB integrity

  • Use temporal analysis to determine if ETNPPL changes precede or follow functional alterations

Advanced experimental designs:

  • Cell-specific knockout or overexpression of ETNPPL to assess causality

  • Patch-clamp recording of ETNPPL+ versus ETNPPL- astrocytes to assess electrophysiological properties

  • Metabolomic analysis to determine impact on phosphoethanolamine metabolism

  • Co-culture systems to assess influence on neuronal growth

Research has demonstrated that ETNPPL expression patterns differ from traditional reactive astrocyte markers like GFAP. While GFAP is consistently upregulated in various pathological conditions, ETNPPL shows model-specific responses, suggesting it may reflect more nuanced functional states of astrocytes beyond simple reactivity .

What techniques can be used to investigate the relationship between ETNPPL expression and astrocyte heterogeneity?

Investigating ETNPPL in the context of astrocyte heterogeneity requires sophisticated methodological approaches:

Single-cell transcriptomics approaches:

  • scRNA-seq to identify astrocyte subpopulations with differential ETNPPL expression

  • ETNPPL-based cell sorting followed by transcriptomic profiling

  • Spatial transcriptomics to preserve regional information while assessing heterogeneity

Multi-parameter immunofluorescence:

  • Combine ETNPPL with multiple astrocyte markers (ALDH1L1, GFAP, GS, AQP4)

  • Include region-specific markers to identify specialized astrocyte populations

  • Utilize high-dimensional analysis techniques (e.g., tSNE, UMAP) for population clustering

Functional assays for subpopulation characterization:

  • Live calcium imaging in ETNPPL+ versus ETNPPL- astrocytes

  • Selective isolation of populations for metabolomic or proteomic profiling

  • Ex vivo or in vitro models to assess functional differences

Computational approaches:

  • Pseudotime analysis to determine developmental trajectories

  • Gene regulatory network analysis to identify transcription factors associated with ETNPPL expression

  • Integration of multi-omic data to comprehensively characterize subpopulations

Research has established that ETNPPL is expressed in only a subset of Gjb6+ astrocytes in the spinal cord, highlighting its utility for identifying specific astrocyte subpopulations . This heterogeneity may reflect functional specialization and could be key to understanding region-specific vulnerabilities in pathological conditions.

What is the potential relationship between ETNPPL and neurodegenerative diseases?

Emerging research suggests complex relationships between ETNPPL and neurodegenerative conditions:

Parkinson's disease connections:

  • Altered ETNPPL expression has been observed in Parkinson's disease patients

  • Potential role in the normal function of dopaminergic neurons

  • May contribute to neuronal stability through mechanisms that remain to be fully elucidated

Experimental approaches to investigate mechanisms:

  • Immunohistochemical analysis of post-mortem tissue from neurodegenerative disease patients

  • Comparison of ETNPPL expression in affected versus unaffected brain regions

  • Correlation with disease progression markers and severity

  • Animal models with ETNPPL manipulation to assess impact on disease progression

Potential pathophysiological mechanisms:

  • Disruption of phospholipid metabolism affecting membrane integrity

  • Alterations in astrocyte-neuron metabolic coupling

  • Changes in astrocyte reactivity affecting neuroinflammatory responses

  • Disruption of neurotransmitter recycling or antioxidant functions

Translational research directions:

  • Development of PET ligands targeting ETNPPL for in vivo imaging

  • ETNPPL as a potential biomarker for disease progression

  • Therapeutic approaches targeting ETNPPL expression or function

While the precise mechanisms remain under investigation, the selective expression of ETNPPL in astrocytes, combined with its altered expression in pathological conditions, suggests it may play important roles in neurodegenerative processes through astrocyte-mediated effects on neuronal health and survival .

How should researchers address inconsistencies in ETNPPL antibody staining patterns?

When facing inconsistent ETNPPL staining results, consider these methodological approaches:

Common sources of variability and solutions:

ProblemPotential CausesSolutions
Weak or absent signalInadequate antigen retrieval, Low antibody concentration, Developmental stage of tissueOptimize HIER conditions (pH, temperature, duration), Increase antibody concentration, Confirm tissue age (expression minimal in neonates)
Non-specific stainingExcessive antibody concentration, Insufficient blocking, Cross-reactivityTitrate antibody, Extend blocking step, Validate with KO tissue or competitive blocking
Regional inconsistenciesNatural heterogeneity, Section plane variabilityMap to precise anatomical locations, Use serial sections, Consider regional expression differences
Batch-to-batch variabilityAntibody lot differences, Processing variationsInclude standard positive controls, Process experimental and control tissues simultaneously

Validation approaches:

  • Compare results with multiple antibody clones (e.g., 50A2, 63B2, 94A3)

  • Confirm findings with complementary techniques (ISH, WB)

  • Include knockout tissue as definitive negative control

Research has demonstrated that ETNPPL expression is highly heterogeneous across brain regions, with highest expression in cerebellum, olfactory bulb, and hypothalamus, and lowest in white matter. Understanding this natural variability is essential when interpreting apparent inconsistencies in staining patterns .

How can contradictory findings in ETNPPL expression changes across different disease models be reconciled?

When confronted with seemingly contradictory findings regarding ETNPPL expression in different models:

Analytical framework for reconciling differences:

  • Temporal considerations: Expression changes may vary at different timepoints post-injury

  • Regional specificity: Compare equivalent anatomical regions across studies

  • Model severity: Consider injury/disease severity as a factor in expression changes

  • Cell subpopulation effects: Analyze whether changes affect all or specific subsets of astrocytes

Methodological considerations:

  • RNA vs. protein level changes may not always correlate

  • Bulk tissue vs. cell-specific measurements can yield different results

  • Technical differences in antibody clones, detection methods, or quantification approaches

Integrative approaches:

  • Meta-analysis techniques to identify patterns across multiple studies

  • Pathway analysis to understand context-dependent regulation

  • Systematic comparison of experimental variables across studies

Research has demonstrated model-specific responses of ETNPPL expression:

  • Downregulation after spinal cord injury, ischemic stroke, and AAV infection

  • Upregulation after hemorrhagic stroke and LPS administration

  • Transient changes after pyramidotomy that normalize by 2 weeks

These differential responses likely reflect distinct astrocyte states or subpopulations responding to specific injury contexts rather than true contradictions .

What are the key considerations when interpreting subcellular localization of ETNPPL?

ETNPPL demonstrates complex subcellular distribution patterns that require careful interpretation:

Predominant localization patterns:

  • Nuclear-dominant in most ETNPPL+ cells

  • Some cells show weak cytosolic expression in addition to nuclear localization

  • Mitochondrial localization has been reported in some contexts

Technical considerations for accurate localization:

  • Fixation methods can affect apparent subcellular distribution

  • Antibody penetration may differ between nuclear and cytoplasmic compartments

  • Z-stack confocal imaging recommended to avoid optical sectioning artifacts

  • Super-resolution microscopy for detailed subcellular distribution

Co-localization analysis approaches:

  • Nuclear markers (DAPI, NeuN) to confirm nuclear localization

  • Mitochondrial markers (TOM20, Mitotracker) to assess mitochondrial association

  • Cytoskeletal markers to evaluate cytoplasmic distribution

  • Quantitative co-localization metrics (Pearson's coefficient, Manders' overlap)

Functional implications of localization:

  • Nuclear localization may suggest roles in transcriptional regulation

  • Mitochondrial localization aligns with metabolic functions

  • Changes in subcellular distribution may indicate functional state transitions

  • Differential localization may reflect distinct astrocyte subpopulations

Research has shown that ETNPPL's subcellular localization is predominantly nuclear in adult astrocytes, though weak cytosolic expression is observed in some cells. This nuclear enrichment is unexpected for a metabolic enzyme and suggests potential non-canonical functions that may include transcriptional regulation .

How might ETNPPL be utilized as a biomarker in clinical research?

Emerging research suggests ETNPPL has potential as a biomarker in several contexts:

Hepatocellular carcinoma applications:

  • Downregulation of ETNPPL correlates with unfavorable prognosis in HCC

  • Diagnostic value demonstrated with AUC of 0.9089 in ROC analysis

  • Association with advanced TNM stage, poor grade, and tumor metastasis

  • Potential therapeutic target based on in vitro evidence of tumor suppressive properties

Neurological disease applications:

  • Altered expression in Parkinson's disease suggests potential as a biomarker

  • Different responses to ischemic versus hemorrhagic stroke may aid in stroke subtype differentiation

  • Expression changes after traumatic injuries may correlate with recovery potential

Methodological approaches for biomarker development:

  • Tissue-based assays using validated antibodies for pathological specimens

  • Potential development of blood-based assays if ETNPPL is released during tissue damage

  • Integration with other biomarkers in multiparameter panels

  • Correlation with clinical outcomes in longitudinal studies

Translational research considerations:

  • Standardization of detection methods for clinical application

  • Establishment of reference ranges across age, sex, and anatomical regions

  • Validation in larger cohorts with appropriate controls

  • Assessment of predictive value for treatment response

Research in HCC has demonstrated that ETNPPL downregulation is associated with poor prognosis and may contribute to lipogenesis in cancer cells. The ROC analysis showed an AUC of 0.9089, suggesting strong potential as a diagnostic biomarker .

What are the potential mechanisms by which ETNPPL influences neural development and regeneration?

Investigating ETNPPL's mechanistic roles represents an emerging research frontier:

Current evidence suggesting developmental/regenerative roles:

  • Minimal expression in developing neonatal spinal cord

  • Increased expression correlating with maturation and reduced plasticity

  • Negative correlation with axonal elongation after pyramidotomy

  • Dynamic regulation in injury models associated with repair processes

Hypothesized molecular mechanisms:

  • Regulation of phospholipid metabolism affecting membrane dynamics during development

  • Potential influence on astrocyte maturation and their subsequent effects on neural circuit stabilization

  • Role in establishing or maintaining the extracellular environment that influences axon growth

  • Possible indirect effects through metabolites influencing gene expression

Advanced experimental approaches to investigate mechanisms:

  • Conditional knockout or overexpression in specific cell populations at defined developmental timepoints

  • In vitro co-culture systems with manipulation of ETNPPL expression

  • Metabolomic analysis to identify ETNPPL-dependent phospholipid changes

  • CRISPR-mediated gene editing to create reporter lines for live imaging of ETNPPL dynamics

Potential therapeutic implications:

  • Targeting ETNPPL to enhance neural regeneration after injury

  • Modulating astrocyte maturation to extend critical periods

  • Manipulating phospholipid metabolism to promote axonal regrowth

Studies have shown that ETNPPL expression is minimal in the developing neonatal spinal cord and increases with maturation. Its expression level slightly decreases after pyramidotomy in adult mice, which correlates with periods of axonal sprouting, suggesting a potential negative regulatory role in axonal growth that could be therapeutically targeted .

How might new technologies advance our understanding of ETNPPL function in normal and pathological conditions?

Emerging technologies offer promising avenues for deeper investigation of ETNPPL:

Spatial multi-omics approaches:

  • Spatial transcriptomics to map ETNPPL expression while preserving tissue architecture

  • Imaging mass cytometry for simultaneous detection of multiple proteins alongside ETNPPL

  • Spatial metabolomics to correlate ETNPPL expression with local metabolite profiles

Advanced genetic manipulation techniques:

  • CRISPR-Cas9 knockin of fluorescent reporters at the ETNPPL locus for live imaging

  • Inducible and cell-type-specific knockout models to study temporal requirements

  • Base editing for introducing specific mutations to study structure-function relationships

Novel imaging technologies:

  • Super-resolution microscopy to reveal nanoscale distribution patterns

  • Live imaging of ETNPPL in organotypic cultures or in vivo through cranial windows

  • Volumetric imaging of cleared tissues for whole-brain ETNPPL mapping

Computational and AI approaches:

  • Machine learning for automated detection of ETNPPL+ cells and their morphological features

  • Integrative multi-omics analysis to place ETNPPL in broader molecular networks

  • Predictive modeling of ETNPPL expression changes in response to therapies

Translational technologies:

  • Development of PET ligands targeting ETNPPL for in vivo imaging

  • Drug screening platforms to identify modulators of ETNPPL expression or function

  • Biomarker development technologies for minimally invasive detection

The development of high-quality monoclonal antibodies against ETNPPL, as described in recent research, has already advanced our understanding of its expression patterns and potential functions. Future integration of these antibodies with emerging technologies will further expand our knowledge of this important molecular marker .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.