ATF7IP2 Antibody

Shipped with Ice Packs
In Stock

Description

Introduction

The ATF7IP2 Antibody is a specialized immunoglobulin designed to detect and study the ATF7IP2 protein (Activating transcription factor 7 interacting protein 2), a critical regulator of histone H3K9 methylation and meiotic gene regulation in germ cells . This antibody is widely used in molecular biology and immunology research to investigate the protein’s roles in meiosis, heterochromatin organization, and retrotransposon suppression . Below is a comprehensive analysis of its characteristics, applications, and research findings.

Key Features of ATF7IP2 Antibody

  • Target Protein: ATF7IP2/MCAF2, a germline-specific protein essential for male fertility .

  • Species Reactivity: Primarily reacts with human and mouse proteins .

  • Antibody Types: Available as polyclonal or monoclonal variants, with conjugated or unconjugated options for different assays .

  • Epitope: Targets regions such as the SETDB1-binding domain (SETDB1-BD) or the N-terminal domain of ATF7IP2 .

3.1. Western Blot (WB)

Validated for detecting ATF7IP2 in lysates from testicular tissues or germ cells . Example protocols include 1:1000 dilution with PVDF membranes and ECL detection .

3.2. Immunohistochemistry (IHC)

Used to localize ATF7IP2 in meiotic prophase I nuclei, particularly on pericentric heterochromatin and sex chromosomes . Recommended dilutions: 1:200–1:500 .

3.3. Immunofluorescence (IF)

Applied in chromosome spreads to visualize ATF7IP2 distribution during meiotic stages (e.g., leptotene, pachytene) .

3.4. Flow Cytometry (FACS)

Utilized to quantify ATF7IP2 expression in germ cells isolated from testes .

Validation and Specificity

  • Orthogonal RNAseq Validation: Confirmed by the Human Protein Atlas project for specificity in human tissues .

  • Protein Array Testing: Cross-reactivity assessed against 364 human recombinant proteins, ensuring low off-target binding .

  • Immunogen Sequence: Targets amino acid residues 1–50 of the N-terminal domain (e.g., SVESPNLTTPITSNPTDTRKITSGNSSNSPNAEVMAVQKKLDSIIDLTKEGLSNCNTESPVSPLESHSKAASNSKETTPLAQNAVQVPESFEHLPPLPEPPAPL) .

6.1. Role in Meiosis

ATF7IP2 is critical for meiotic sex chromosome inactivation (MSCI) and heterochromatin organization . Antibody staining revealed its localization on pericentric heterochromatin (PCH) and sex chromosomes during meiotic prophase I .

6.2. Retrotransposon Suppression

ATF7IP2 recruits SETDB1 to retrotransposon loci, enabling H3K9me3-mediated silencing . Antibody-based assays confirmed its absence leads to retrotransposon activation and meiotic arrest .

6.3. Cancer Research

Emerging studies use ATF7IP2 antibodies to investigate its role in germ cell tumors, where its expression correlates with tumor progression .

Product Specs

Buffer
Preservative: 0.03% Proclin 300
Constituents: 50% Glycerol, 0.01M PBS, pH 7.4
Form
Liquid
Lead Time
Made-to-order (12-14 weeks)
Synonyms
Activating transcription factor 7-interacting protein 2 (ATF7-interacting protein 2) (MBD1-containing chromatin-associated factor 2), ATF7IP2, MCAF2
Target Names
ATF7IP2
Uniprot No.

Target Background

Function
ATF7IP2 Antibody is a recruiter that links transcriptional factors to the general transcription apparatus, thereby modulating transcription regulation and chromatin formation. It can act as both an activator or a repressor depending on the cellular context. ATF7IP2 mediates MBD1-dependent transcriptional repression, likely by recruiting complexes containing SETDB1. The complex formed with MBD1 and SETDB1 represses transcription and probably couples DNA methylation and histone H3 lysine 9 trimethylation (H3K9me3) activity (Probable).
Gene References Into Functions
  1. Clinical trial and genome-wide association study of gene-disease association. (HuGE Navigator) PMID: 20195266
  2. These data suggest that the MBD1.MCAF1.SETDB1 complex facilitates the formation of heterochromatic domains, highlighting the role of MCAF/AM family proteins in epigenetic control. This study describes a new family member, MCAF2 (ATF7IP2). PMID: 15691849
Database Links

HGNC: 20397

OMIM: 613645

KEGG: hsa:80063

STRING: 9606.ENSP00000348799

UniGene: Hs.513343

Protein Families
MCAF family
Subcellular Location
Nucleus.

Q&A

What is ATF7IP2 and why is it significant in reproductive biology research?

ATF7IP2 (Activating Transcription Factor 7 Interacting Protein 2), also known as MCAF2, is a germline-specific protein that functions as a critical regulator of H3K9 methylation and heterochromatin organization in male meiosis. It is highly expressed in testes, particularly in meiotic spermatocytes, and plays essential roles in male fertility, meiotic sex chromosome inactivation (MSCI), suppression of retrotransposons, and global regulation of autosomal genes . Mouse ATF7IP2 shares high homology with human ATF7IP2, with the exception of its long N-terminal amino acid tail, suggesting evolutionary conservation of function . Due to its critical role in male reproductive biology, ATF7IP2 has become an important target for antibody-based detection in reproductive research.

What are the available epitope targets for ATF7IP2 antibodies?

Commercial ATF7IP2 antibodies typically target specific amino acid sequences within the protein. Common epitope regions include amino acids 318-347 from the central region of human ATF7IP2 (MCAF2) . This region has been validated for antibody generation through KLH conjugated synthetic peptide immunization . Other available antibody targets include amino acids 100-149 and 325-355, which provide researchers with options to select antibodies targeting different functional domains of the protein .

What experimental applications are supported by ATF7IP2 antibodies?

ATF7IP2 antibodies support multiple experimental applications:

  • Western Blotting (WB): For protein expression quantification and molecular weight confirmation

  • Flow Cytometry (FACS): For cellular analysis and sorting of ATF7IP2-expressing cells

  • Immunohistochemistry (IHC): For tissue localization studies, particularly in paraffin-embedded sections

  • Enzyme-Linked Immunosorbent Assay (ELISA): For quantitative protein detection

These applications enable researchers to investigate ATF7IP2 expression, localization, and function in various experimental contexts, particularly in reproductive biology research.

How should ATF7IP2 antibody be selected for studying its interaction with SETDB1?

When investigating ATF7IP2's interaction with histone methyltransferase SETDB1, researchers should select antibodies targeting the SETDB1-binding domain (SETDB1-BD) of ATF7IP2, which is conserved between ATF7IP2 and ATF7IP . For co-immunoprecipitation experiments, consider using antibodies that do not interfere with the ATF7IP2-SETDB1 interaction. Antibodies targeting amino acids 318-347 in the central region of ATF7IP2 may be suitable for this purpose .

For immunofluorescence co-localization studies, use antibodies validated for immunofluorescence applications with minimal cross-reactivity. When designing experiments to study this interaction, include appropriate controls:

  • Negative controls: IgG isotype controls

  • Positive controls: Known interacting partners

  • Competition assays: Using recombinant ATF7IP2 protein to confirm antibody specificity

What controls are essential when using ATF7IP2 antibodies in immunofluorescence studies of meiotic cells?

When studying ATF7IP2 localization during meiosis using immunofluorescence microscopy, the following controls are essential:

  • Knockout/Knockdown Validation: Include Atf7ip2-/- samples as negative controls to confirm antibody specificity. As demonstrated in studies, immunofluorescence signal should be absent in Atf7ip2-/- spermatocytes .

  • Stage-Specific Controls: Include markers for meiotic stages such as SYCP3 (a marker of chromosome axes) to accurately identify leptotene, zygotene, pachytene, and diplotene stages .

  • Co-localization Controls: Use DAPI to identify heterochromatin regions, particularly pericentric heterochromatin (PCH), to confirm ATF7IP2's localization pattern .

  • Blocking Peptide Controls: Perform antibody pre-absorption with the immunizing peptide to demonstrate specificity of the immunofluorescence signal.

  • Secondary Antibody Controls: Include samples with only secondary antibody to identify any background or non-specific staining.

How can ATF7IP2 antibodies be optimized for detecting dynamic changes in ATF7IP2 localization during meiotic progression?

Detecting dynamic changes in ATF7IP2 localization during meiotic progression requires optimized immunofluorescence protocols:

  • Antibody Concentration Optimization: Titrate antibody concentrations (typically 1:100 to 1:1000) to determine optimal signal-to-noise ratio for different meiotic stages.

  • Sample Preparation Method: Use chromosome spreads rather than tissue sections for higher resolution of chromatin structures. As demonstrated in research protocols, fixation with 4% paraformaldehyde for 20 minutes at room temperature followed by permeabilization with 0.2% Triton X-100 provides good results .

  • Multi-color Immunofluorescence: Combine ATF7IP2 antibody with stage-specific markers:

    • SYCP3 for axis structure

    • γH2AX for DNA damage response and sex body formation

    • H1T for mid-to-late pachytene stages

    • MLH1 for crossover sites

  • High-Resolution Imaging: Use confocal microscopy with Z-stacking to capture the three-dimensional distribution of ATF7IP2 on heterochromatin .

  • Quantitative Analysis: Implement image analysis workflows using software like ImageJ to quantify signal intensity changes across meiotic stages .

What strategies can overcome potential cross-reactivity between ATF7IP2 and ATF7IP antibodies?

ATF7IP2 shares homology with ATF7IP, particularly in the SETDB1-binding domain, which can lead to cross-reactivity issues . To overcome this:

  • Epitope Selection: Choose antibodies targeting unique regions of ATF7IP2 not shared with ATF7IP. The N-terminal region of mouse ATF7IP2, which differs significantly from human ATF7IP2 and ATF7IP, is a good target for specific detection .

  • Validation in Knockout Models: Test antibody specificity in Atf7ip2-/- tissues as demonstrated in published research, where ATF7IP2 immunofluorescence signal should be absent .

  • Pre-absorption Controls: Perform antibody pre-absorption with recombinant ATF7IP and ATF7IP2 proteins separately to identify any cross-reactivity.

  • Western Blot Validation: Confirm antibody specificity by detecting the correct molecular weight band for ATF7IP2 distinct from ATF7IP.

  • Tissue-Specific Expression: Leverage the differential expression pattern - ATF7IP2 is highly expressed in testes while ATF7IP is more ubiquitously expressed .

How should researchers interpret discrepancies in ATF7IP2 localization patterns between different antibodies?

When facing discrepancies in ATF7IP2 localization patterns between different antibodies:

  • Epitope Accessibility Analysis: Different epitopes may be differentially accessible in various subcellular compartments or protein complexes. Antibodies targeting the central region (AA 318-347) may detect different subpopulations than those targeting other regions .

  • Fixation-Dependent Effects: Compare results across different fixation methods; paraformaldehyde fixation may preserve some epitopes better than others.

  • Antibody Format Considerations: Compare unconjugated antibodies versus conjugated versions (FITC, HRP, Biotin) which may have different sensitivity or specificity profiles .

  • Technique-Specific Differences: Recognize that patterns observed in chromosome spreads may differ from those in tissue sections or whole cells due to differences in sample preparation .

  • Biological Context: Consider that ATF7IP2 localization changes during meiotic progression, from leptotene (when it localizes on DAPI-discernible heterochromatin) through diplotene stages .

What methodological adaptations are needed when using ATF7IP2 antibodies in different species?

When adapting ATF7IP2 antibody protocols across species:

  • Sequence Homology Assessment: Despite high homology between human and mouse ATF7IP2, the mouse protein has a unique long N-terminal amino acid tail that may affect antibody binding . Verify epitope conservation in your target species.

  • Antibody Validation: Confirm reactivity in your species of interest; many commercial antibodies are validated for both human and mouse samples but may require additional validation for other species .

  • Protocol Optimization:

    • Antigen retrieval methods may need species-specific optimization

    • Antibody concentrations may need adjustment (typically higher concentrations for less conserved epitopes)

    • Incubation times may need extension for cross-species applications

  • Species-Specific Controls: Include species-appropriate positive controls (e.g., testis tissue where ATF7IP2 is highly expressed) and negative controls (tissues with low expression) .

  • Cross-Species Validation: When possible, validate findings with multiple antibodies or complementary techniques (e.g., mRNA expression).

How can ATF7IP2 antibodies be applied to investigate infertility mechanisms in knockout or mutant models?

ATF7IP2 antibodies offer powerful tools for investigating infertility mechanisms in genetic models:

  • Phenotypic Characterization: Use immunohistochemistry with ATF7IP2 antibodies to assess testicular architecture in wild-type versus mutant tissues. Atf7ip2-/- males exhibit smaller testes devoid of haploid spermatids and smaller seminiferous tubules .

  • Meiotic Progression Analysis: Apply immunofluorescence with ATF7IP2 antibodies alongside stage-specific markers to determine where meiotic arrest occurs. Research shows Atf7ip2-/- spermatocytes arrest in meiotic prophase I, specifically as they transition from pachytene to diplotene stages .

  • Functional Pathway Assessment: Use ATF7IP2 antibodies in combination with:

    • γH2AX to assess DNA damage response signaling

    • H3K9me3 to evaluate heterochromatin formation

    • SYCP1/SYCP3 to analyze synapsis completion

    • MLH1 to evaluate crossover formation

  • Molecular Mechanism Investigation: Employ ATF7IP2 antibodies in chromatin immunoprecipitation (ChIP) experiments to identify genomic targets affected in mutant models.

  • Rescue Experiments: Use ATF7IP2 antibodies to verify expression of rescue constructs in complementation studies of knockout models.

What methodological approaches can resolve contradictory findings regarding ATF7IP2 function in meiotic sex chromosome inactivation?

When addressing contradictory findings regarding ATF7IP2's role in meiotic sex chromosome inactivation (MSCI):

  • Temporal Resolution Analysis: Use staged spermatocyte collections with ATF7IP2 antibodies to precisely track temporal dynamics of ATF7IP2 localization relative to MSCI initiation and maintenance .

  • Combined Protein-RNA Analysis: Perform immunofluorescence with ATF7IP2 antibodies followed by RNA FISH to simultaneously evaluate protein localization and transcriptional status of sex-linked genes.

  • Comparative Analysis of Different Knockout Models: Different studies may use distinct knockout strategies (e.g., deletion of different exons). The study cited used a 17-bp deletion in exon 4, while another study may have used a different approach. Compare phenotypes using the same ATF7IP2 antibodies across models .

  • High-Resolution Co-Localization Studies: Use super-resolution microscopy with ATF7IP2 antibodies and markers of MSCI (e.g., γH2AX, H3K9me3) to resolve spatial relationships with greater precision than standard confocal approaches.

  • Experimental Approach Reconciliation: Some studies found differences in MLH1 association with pseudoautosomal regions (PARs) while others did not. Standardize scoring criteria and increase sample sizes to resolve these contradictions .

How can ATF7IP2 antibodies be employed to explore potential therapeutic targets for male infertility?

ATF7IP2 antibodies can facilitate exploration of therapeutic targets for male infertility through:

  • Biomarker Development: Use ATF7IP2 antibodies to screen testicular biopsies from infertile patients to determine if ATF7IP2 expression or localization is altered in specific infertility syndromes.

  • Pathway Mapping: Apply proximity ligation assays with ATF7IP2 antibodies to identify critical protein-protein interactions that could serve as druggable targets.

  • Functional Screening: Develop cell-based assays using ATF7IP2 antibodies to screen compounds that might restore proper ATF7IP2 localization or function in models of disrupted spermatogenesis.

  • Translational Studies: Evaluate ATF7IP2 expression patterns in human testicular tissue using validated antibodies, building on observations that ATF7IP2 is highly expressed in human meiotic spermatocytes .

  • Genetic Variant Characterization: Use ATF7IP2 antibodies to assess the impact of human ATF7IP2 variants on protein stability, localization, and function in cellular models.

What methodological approaches can integrate ATF7IP2 antibody-based studies with emerging genomic and proteomic technologies?

Integration of ATF7IP2 antibody techniques with cutting-edge genomic and proteomic approaches:

  • ChIP-seq Applications: Optimize ATF7IP2 antibodies for chromatin immunoprecipitation followed by sequencing to map global genomic binding sites and associated histone modifications, particularly H3K9me3 .

  • CRISPR Screens with Antibody Readouts: Combine genome-wide CRISPR screens with high-content imaging using ATF7IP2 antibodies to identify genes affecting ATF7IP2 localization or function.

  • Single-Cell Approaches: Adapt ATF7IP2 antibodies for single-cell proteomic techniques to understand heterogeneity in expression and function across different stages of spermatogenesis.

  • Spatial Transcriptomics Integration: Correlate ATF7IP2 antibody staining patterns with spatial transcriptomic data to link protein localization with local gene expression changes.

  • Mass Spectrometry Enhancement: Use ATF7IP2 antibodies for immunoprecipitation coupled with mass spectrometry to identify stage-specific or context-specific interaction partners beyond the known SETDB1 interaction .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.