ATP9B antibody is a specialized immunological tool designed to detect and study ATP9B, a class 2 P4-ATPase involved in phospholipid translocation and intracellular membrane trafficking. Unlike most P4-ATPases, ATP9B localizes exclusively to the trans-Golgi network (TGN) and operates independently of CDC50 chaperone proteins for endoplasmic reticulum (ER) exit, a unique feature critical for its functional analysis . This antibody enables researchers to investigate ATP9B's role in secretory pathways, lipid asymmetry, and disease mechanisms.
ATP9B antibodies are used to:
Map subcellular localization: Confirm TGN-specific distribution via immunofluorescence .
Study protein-protein interactions: Detect ATP9B homomeric/heteromeric complexes (e.g., with ATP9A) using co-immunoprecipitation .
Analyze secretory pathways: Assess ATP9B's role in post-Golgi vesicle transport (e.g., VSVG-tsO45 trafficking assays) .
Investigate lipid asymmetry: Monitor phospholipid flipping activity in KO cell models .
ATP9A mutations: Linked to neurodevelopmental disorders with pontocerebellar hypoplasia . While ATP9B mutations are less characterized, its functional overlap with ATP9A suggests potential roles in neurological or metabolic diseases .
Lipid metabolism: ATP9B’s phospholipid translocase activity may influence bile canalicular membrane integrity, analogous to ATP8B1 dysfunction in cholestasis .
Epitope tags: Studies frequently use HA- or FLAG-tagged ATP9B constructs for immunoprecipitation and immunoblotting .
Validation techniques:
STRING: 7955.ENSDARP00000114850
UniGene: Dr.85449
ATP9B is a P4-ATPase (Type IV P-type ATPase), functioning as a putative phospholipid flippase that translocates phospholipids from the exoplasmic (lumenal) to the cytoplasmic leaflet of lipid bilayers . Unlike most P4-ATPases, ATP9B (along with ATP9A) has a distinctive characteristic: it can exit the endoplasmic reticulum without requiring exogenous CDC50 protein expression . ATP9B is primarily localized to the trans-Golgi network (TGN) and endosomes, where it likely contributes to membrane trafficking processes .
When designing experiments to study ATP9B function, researchers should note that it forms either homomeric or heteromeric complexes, particularly with ATP9A, which affects its cellular distribution and function .
Based on validated antibody performance data, ATP9B antibodies are suitable for multiple applications with varying recommended dilutions:
| Application | Recommended Dilution | Validated Antibody Examples | Species Reactivity |
|---|---|---|---|
| Immunohistochemistry (IHC) | 1:20 - 1:50 | HPA029364, NBP1-88906 | Human |
| Western Blot (WB) | 1:500 - 1:2000 | abx254129 | Human |
| ELISA | 1:20000 - 1:80000 | abx254129 | Human |
| Immunocytochemistry (ICC-IF) | Varies by antibody | HPA029364 | Human |
For optimal results, each antibody should be validated in your specific experimental system before conducting critical experiments .
A systematic approach to ATP9B antibody validation should include:
Positive controls: Use tissues or cell lines with known ATP9B expression (e.g., HeLa cells) .
Negative controls: Implement CRISPR/Cas9-generated ATP9B knockout cells as described in recent literature .
Specificity testing: Confirm target specificity through protein arrays or Western blot band patterns.
Cross-reactivity assessment: Several ATP9B antibodies are predicted to cross-react with mouse and rat ATP9B (approximately 78-79% sequence identity to human) .
Validation across multiple applications: Don't assume an antibody that works for IHC will necessarily perform well in WB or other applications.
For enhanced validation strategies, researchers have used protein arrays containing the target protein plus 383 other non-specific proteins to verify specificity .
Recent research demonstrates that ATP9A and ATP9B form homomeric and heteromeric complexes, requiring specialized techniques for analysis . The most effective approaches include:
Co-immunoprecipitation (Co-IP): Establish cell lines stably coexpressing HA-tagged and FLAG-tagged ATP9A and ATP9B in various combinations. Perform Co-IP using anti-HA antibodies coupled to Protein G-Dynabeads, followed by immunoblot analysis with anti-FLAG antibodies .
Blue Native PAGE (BN-PAGE): This non-denaturing electrophoresis technique is crucial for preserving protein complex integrity. Recent studies identified ATP9A-HA and ATP9B-HA migration at approximately 470~480 kDa and 240 kDa, respectively, suggesting complex formation .
Double knockout models: To avoid interference from endogenous proteins, generate ATP9A/9B double knockout (DKO) cells using CRISPR/Cas9 technology before expressing tagged versions for complex analysis .
Mutational analysis: Create EQ mutants (catalytically inactive forms) of ATP9A and ATP9B to assess whether ATPase activity influences complex formation .
Based on recent successful implementations, a methodical approach for ATP9B gene editing includes:
Target sequence design: Utilize established tools such as the CRISPR Design Tool (http://crispr.mit.edu/) to identify optimal target sequences. Recent work successfully used 5′-caccgcgggagccgaccggcacagc-3′ and 5′-aaacgctgtgccggtcggctcccgc-3′ as complementary oligonucleotides .
Vector construction: Insert designed oligonucleotides into BbsI-digested PX459 vector (Addgene #48139) containing the Cas9 gene .
Donor plasmid co-transfection: Use a donor plasmid such as pDonor-tBFP-NLS-Neo (Addgene #80766) alongside the CRISPR construct .
Cell transfection and selection: Transfect target cells (e.g., HeLa) using an appropriate transfection reagent like X-tremeGENE9. Select transfected cells using G418 (1 mg/mL) .
Clone isolation and verification: Isolate clones based on reporter gene expression (e.g., Tag-BFP) using flow cytometry. Confirm editing by PCR amplification of the target region and direct sequencing .
Functional validation: Verify protein loss through immunoblotting and assess phenotypic changes in membrane trafficking or other cellular processes .
This comprehensive approach ensures the generation of reliable knockout models for studying ATP9B function.
ATP9B has distinct localization patterns that require careful experimental design:
Subcellular markers: Co-localization studies should include markers for the trans-Golgi network (e.g., Golgin97) and endosomal compartments .
ATP9A-ATP9B relationship: ATP9B contributes to the localization of ATP9A to the TGN, possibly through direct interaction. Design experiments to assess how ATP9B depletion affects ATP9A distribution .
Interaction with membrane trafficking machinery: Investigate potential interactions with ARF-like protein ARL1, which localizes to the TGN and plays a crucial role in Golgi-mediated membrane trafficking through its effectors, Arfaptin 1 and 2 .
Vesicular transport assays: Implement VSVG protein trafficking assays detected with anti-GFP antibodies to assess the role of ATP9B in membrane trafficking pathways .
Live cell imaging: For dynamic studies of ATP9B trafficking, use fluorescently tagged constructs and time-lapse microscopy.
When comparing wild-type and ATP9B-depleted cells, researchers have observed that while ATP9A localization changes, the distribution of Golgin97 and other trafficking proteins remains consistent, suggesting specific rather than general effects on membrane organization .
P4-ATPases share significant sequence homology, presenting challenges for specific detection:
Antibody epitope selection: Choose antibodies raised against unique regions of ATP9B. The immunogen sequence "GTVSYGADTMDEIQSHVRDSYSQMQSQAGGNNTGSTPLRKAQSSAPKVRKSVSSRIHEAVKAIVLCHNVTPVYESRAGVTEETEFAEADQDFSDENR" has been successfully used to generate specific antibodies .
Functional distinction: Unlike most P4-ATPases, ATP9B does not require CDC50A for ER exit or localization, providing a functional characteristic for differentiation .
Molecular weight verification: Recombinant ATP9B protein has been observed at approximately 37 kDa, while the native protein complex appears at approximately 240 kDa in BN-PAGE analysis .
Cross-reactivity testing: Test antibodies against multiple P4-ATPases, particularly ATP9A which shares the highest similarity and functional overlap with ATP9B .
Gene-specific knockdown/knockout: Use siRNA or CRISPR/Cas9 targeting specific regions of ATP9B to confirm antibody specificity and distinguish between closely related family members .
Based on successful research implementations, the following protocol has proven effective:
Cell lysis: Lyse cells in buffer containing 20 mM HEPES (pH 7.4), 150 mM NaCl, 1% Nonidet P-40, 1 mM EDTA, supplemented with protease inhibitor mixture at 4°C for 30 min .
Lysate clarification: Centrifuge lysates at maximum speed for 20 min at 4°C in a microcentrifuge to remove cellular debris and insoluble materials .
Immunoprecipitation: Incubate the supernatant at 4°C for 15 min with an anti-HA antibody, followed by further incubation at 4°C for 16 h with Protein G-coupled Dynabeads .
Washing and elution: Wash beads thoroughly and elute bound proteins by incubating at 37°C for 2 h in SDS sample buffer .
Analysis: Subject the supernatant to immunoblot analysis using appropriate antibodies (anti-HA, anti-FLAG) to detect ATP9B and its interaction partners .
This protocol has successfully demonstrated interactions between ATP9B and related proteins in multiple studies .
For reliable ATP9B detection in tissue sections, researchers should consider:
Fixation: Standard formalin fixation followed by paraffin embedding works effectively for ATP9B detection .
Antibody dilution: Most validated antibodies work optimally at dilutions between 1:20-1:50 for IHC applications .
Antigen retrieval: Heat-induced epitope retrieval in citrate buffer (pH 6.0) has been successfully employed for ATP9B detection.
Detection system: Use a high-sensitivity detection system such as polymer-based detection with DAB chromogen.
Positive control selection: Human tissues with known expression of ATP9B should be included as positive controls.
Counterstaining: Light hematoxylin counterstaining allows visualization of tissue architecture without obscuring specific ATP9B staining.
Because ATP9B has a distinct localization pattern primarily at the trans-Golgi network and endosomes, proper fixation that preserves subcellular structures is critical for accurate localization studies .
When investigating ATP9B functions such as phospholipid flipping or membrane trafficking:
Controls: Include both negative controls (ATP9B knockout) and positive controls (rescue experiments with wild-type ATP9B expression) .
Quantitative measurements: Implement quantitative analysis of microscopy data using software like ImageJ to measure colocalization coefficients or vesicular distribution patterns.
Statistical approach: Use appropriate statistical tests (typically ANOVA with post-hoc comparisons) to analyze differences between experimental conditions.
Time-course analysis: For dynamic processes like membrane trafficking, conduct time-course experiments to capture the temporal aspects of ATP9B function.
Multi-parameter analysis: Consider analyzing multiple parameters simultaneously (localization, protein-protein interactions, phospholipid distribution) to develop a comprehensive understanding of ATP9B function.
Recent studies have successfully employed these analytical approaches to distinguish specific effects of ATP9B from general disruptions of membrane organization or trafficking machinery .
Researchers frequently encounter several challenges when working with ATP9B antibodies:
When troubleshooting, methodically test each variable independently while maintaining appropriate controls to identify the specific source of the issue.
To maximize reproducibility when studying ATP9B:
Standardize antibody validation: Implement a consistent validation workflow for each new antibody lot, including positive and negative controls.
Document precise protocols: Record detailed protocols including buffer compositions, incubation times, temperatures, and equipment settings.
Use consistent cell models: Establish and maintain stable cell lines for consistent expression levels, especially for tagged ATP9B constructs .
Batch processing: Process experimental and control samples together to minimize technical variation.
Independent verification: Confirm key findings using multiple detection methods (e.g., both immunofluorescence and biochemical approaches).
Control for post-translational modifications: Consider that ATP9B function may be regulated by phosphorylation or other modifications that could affect antibody recognition.
These approaches have been successfully implemented in recent studies examining ATP9B's role in complex formation and membrane trafficking .
Several cutting-edge approaches are advancing our understanding of ATP9B biology:
Cryo-electron microscopy: This technique is being applied to elucidate the structural basis of ATP9B function and complex formation.
Advanced live-cell imaging: Super-resolution microscopy combined with fluorescently tagged ATP9B provides unprecedented insights into dynamic localization and trafficking.
Lipidomics integration: Mass spectrometry-based lipidomics now allows researchers to connect ATP9B function with changes in membrane lipid composition.
Proximity labeling: BioID or APEX2 fusion proteins enable identification of the ATP9B interactome in different cellular compartments.
Single-molecule tracking: This technique can reveal the dynamics of individual ATP9B molecules in living cells.
These approaches, combined with established biochemical and cell biological methods, promise to provide a more comprehensive understanding of ATP9B's role in membrane biology and cellular trafficking pathways .
ATP9B research has broader implications for several areas:
Membrane asymmetry: As a putative phospholipid flippase, ATP9B likely contributes to membrane asymmetry, which is critical for various cellular processes including apoptosis, cytokinesis, and vesicular transport .
Golgi function: ATP9B's localization to the trans-Golgi network suggests involvement in secretory pathway regulation, potentially impacting protein glycosylation and sorting .
Endocytic recycling: The presence of ATP9B in endosomal compartments indicates a potential role in endocytic recycling pathways, which are crucial for receptor homeostasis .
Neurodevelopmental disorders: Several P4-ATPases have been implicated in neurological disorders, raising questions about ATP9B's potential role in brain development and function.
Cancer biology: Membrane trafficking defects are increasingly recognized as contributors to cancer progression, suggesting potential roles for ATP9B in malignancy.
Future research directions should explore these connections through interdisciplinary approaches combining cell biology, genetics, and clinical studies .