avl9 Antibody

What is AVL9 and why is it important to study?

AVL9 (also known as KIAA0241) is a late secretory pathway protein homolog that plays a significant role in cell migration processes. It is conserved across multiple species and functions in post-Golgi transport pathways. Understanding AVL9's cellular function requires specific antibodies that can reliably detect and isolate this protein in experimental settings . The protein has been identified as approximately 72 kDa in molecular weight, making it an important target for cellular trafficking and migration studies .

What types of AVL9 antibodies are available for research?

AVL9 antibodies are available in multiple formats to accommodate different experimental needs. The most common types include:

• Unconjugated antibodies: Used primarily for Western blotting, immunohistochemistry, and immunofluorescence applications

• Conjugated antibodies: Available with several labels:

  • HRP (horseradish peroxidase) conjugates for enhanced chemiluminescence detection

  • FITC conjugates for fluorescence microscopy applications

  • Biotin conjugates for amplification systems and complex detection methods

  • APC conjugates for flow cytometry applications

Most commercially available antibodies are polyclonal, raised in rabbits, and target different regions of the AVL9 protein (N-terminal, middle region, or C-terminal) .

What is the epitope specificity of available AVL9 antibodies?

AVL9 antibodies target various epitopes across the protein sequence. Common epitope regions include:

• The C-terminal region (amino acids 619-648) of human AVL9

• The middle region with the sequence DGVTEGLPEEQKKTMADRNLDQLLSNLEDLSNSIQKLHLAENAEPEEQSA

• The N-terminus (as in the AVL9 N-20 antibody)

Selecting antibodies targeting different epitopes can be advantageous for validation purposes and to ensure detection of specific protein variants or isoforms .

What are the validated applications for AVL9 antibodies?

AVL9 antibodies have been validated for multiple experimental applications:

These applications allow researchers to detect AVL9 protein expression, localization, and interactions in various experimental contexts .

How should Western blot protocols be optimized for AVL9 detection?

When performing Western blots for AVL9 detection, researchers should consider the following optimization steps:

• Sample preparation: Use appropriate lysis buffers containing protease inhibitors to prevent degradation of AVL9 protein.

• Gel percentage: Since AVL9 has a molecular weight of approximately 72 kDa, 8-10% SDS-PAGE gels are recommended for optimal separation .

• Transfer conditions: Use semi-dry or wet transfer methods with methanol-containing buffers to ensure efficient transfer of the protein.

• Blocking: 5% non-fat dry milk or BSA in TBST is typically effective for reducing background.

• Primary antibody incubation: Most protocols recommend dilutions between 1:100-1:1000 in blocking buffer, with overnight incubation at 4°C .

• Detection method: Choose appropriate secondary antibodies based on the host species (typically rabbit IgG for most commercial AVL9 antibodies) .

What controls should be included when working with AVL9 antibodies?

Proper experimental controls are essential for reliable results with AVL9 antibodies:

• Positive controls: Cell lines or tissues known to express AVL9 (based on published literature).

• Negative controls:

  • Primary antibody omission control

  • Isotype control (rabbit IgG at the same concentration)

  • Blocking peptide competition assays using available blocking peptides

• siRNA/shRNA knockdown: Several vendors provide validated AVL9 siRNA (sc-89681 for human, sc-140400 for mouse) and shRNA plasmids to create knockdown controls .

• Loading controls: Use appropriate housekeeping proteins when quantifying AVL9 expression levels.

How can researchers validate the specificity of AVL9 antibodies?

Antibody validation is crucial for ensuring experimental reliability. For AVL9 antibodies, consider these validation approaches:

• Peptide competition assays: Pre-incubate the antibody with blocking peptides (such as AAP82953 for the middle region antibody) to confirm specificity .

• Multiple antibody comparison: Use antibodies targeting different epitopes of AVL9 to confirm detection patterns.

• Genetic approaches: Compare signals between wild-type samples and those with AVL9 knockdown using available siRNA (sc-89681 for human, sc-140400 for mouse) or shRNA lentiviral particles .

• Cross-species reactivity: Confirm expected patterns across species (most AVL9 antibodies react with human and mouse) .

• Mass spectrometry validation: For definitive confirmation, immunoprecipitate AVL9 and analyze by mass spectrometry.

What are common issues in AVL9 immunodetection and how can they be resolved?

Researchers may encounter several challenges when working with AVL9 antibodies:

• High background:

  • Increase blocking time/concentration

  • Optimize antibody dilution

  • Add 0.1-0.5% Tween-20 to washing buffers

  • Consider alternative blocking reagents

• Weak or absent signal:

  • Ensure appropriate sample preparation preserves protein integrity

  • Try different epitope-targeting antibodies

  • Concentrate protein sample if expression is low

  • Use signal enhancement systems (TSA, ABC system)

• Non-specific bands:

  • Increase antibody dilution

  • Use freshly prepared samples

  • Try different lysis buffers

  • Confirm with blocking peptide competition

• Inconsistent results:

  • Standardize protocols across experiments

  • Document lot numbers of antibodies used

  • Maintain consistent incubation times and temperatures

How can AVL9 antibodies be used in co-immunoprecipitation studies?

Co-immunoprecipitation (Co-IP) with AVL9 antibodies can reveal protein interaction partners:

• Antibody selection: Choose unconjugated antibodies that have been affinity-purified, such as the peptide affinity-purified rabbit polyclonal antibody .

• Lysis conditions: Use mild, non-denaturing lysis buffers to preserve protein-protein interactions.

• Pre-clearing: Pre-clear lysates with Protein A/G beads to reduce non-specific binding.

• IP protocol:

  • Incubate 1-5 μg of AVL9 antibody with 500-1000 μg of pre-cleared lysate overnight at 4°C

  • Add Protein A/G beads for 1-2 hours

  • Wash thoroughly with IP buffer (at least 3-5 washes)

  • Elute with SDS sample buffer or specific peptide elution

• Controls: Include an isotype control (rabbit IgG) IP performed in parallel to identify non-specific interactions.

How can AVL9 antibodies be utilized to study cell migration?

Since AVL9 functions in cell migration, antibodies can be valuable tools for studying this process:

• Immunofluorescence microscopy: Use FITC-conjugated or unconjugated AVL9 antibodies (at 1:50-1:500 dilution) to visualize subcellular localization during migration .

• Live cell imaging: Consider using membrane-permeable fluorescently labeled AVL9 antibody fragments to track dynamic changes during migration.

• Wound healing assays: Perform immunostaining at different time points after scratch to correlate AVL9 expression/localization with migration rate.

• Transwell migration assays: Compare AVL9 expression in migrated versus non-migrated cells.

• Function-blocking experiments: Test if antibodies targeting extracellular or functional domains of AVL9 affect migration when added to culture medium.

What approaches can be used to study AVL9's role in the secretory pathway?

As a late secretory pathway protein, AVL9 can be studied using several approaches:

• Co-localization studies: Use AVL9 antibodies alongside markers for different secretory compartments (Golgi, post-Golgi vesicles, plasma membrane).

• Secretion assays: Measure the impact of AVL9 knockdown/overexpression on protein secretion, correlating with AVL9 levels detected by antibodies.

• Vesicle isolation: Use AVL9 antibodies for immunoisolation of secretory vesicles containing AVL9.

• Pulse-chase experiments: Track newly synthesized proteins through the secretory pathway, correlating with AVL9 distribution as detected by immunofluorescence.

• Super-resolution microscopy: Employ techniques like STORM or STED with AVL9 antibodies to precisely locate AVL9 within the secretory network.

How should researchers quantify AVL9 expression levels?

Accurate quantification of AVL9 expression requires appropriate methods:

• Western blot densitometry:

  • Use digital image analysis software (ImageJ, Image Studio Lite, etc.)

  • Normalize AVL9 band intensity to loading controls (β-actin, GAPDH, tubulin)

  • Ensure signal is within linear range of detection

• Flow cytometry quantification:

  • Use fluorescently-labeled AVL9 antibodies (FITC or APC conjugates)

  • Include calibration beads for absolute quantification

  • Calculate mean/median fluorescence intensity

• ELISA-based quantification:

  • Develop sandwich ELISA using available antibody pairs

  • Generate standard curves with recombinant AVL9

  • Calculate concentration based on absorbance values

• Immunohistochemistry scoring:

  • Use established scoring systems (H-score, Allred score)

  • Consider both staining intensity and percentage of positive cells

  • Employ digital pathology software for objective assessment

What factors might cause contradictory results when using different AVL9 antibodies?

Discrepancies between results obtained with different AVL9 antibodies may stem from:

• Epitope accessibility: Different epitopes may be masked in certain cellular contexts or protein conformations.

• Isoform specificity: Some antibodies may detect only specific isoforms or post-translationally modified forms.

• Cross-reactivity: Antibodies may recognize homologous proteins, particularly when using antibodies from different host species.

• Fixation sensitivity: Some epitopes may be altered or destroyed by specific fixation methods.

• Batch variability: Different lots of the same antibody may show performance variations.

To address these issues, researchers should:

• Use multiple antibodies targeting different epitopes

• Document antibody catalog numbers and lot numbers

• Validate antibodies in their specific experimental context

• Consider using orthogonal methods to confirm findings

What are emerging applications for AVL9 antibodies in research?

AVL9 antibodies are finding utility in evolving research areas:

• Single-cell analysis: Combining AVL9 antibodies with single-cell technologies to understand cell-to-cell variation in expression.

• Spatial transcriptomics: Correlating AVL9 protein localization with gene expression patterns in tissue sections.

• Extracellular vesicle research: Investigating whether AVL9 is present in exosomes or other extracellular vesicles.

• High-throughput drug screening: Using AVL9 antibodies in automated immunofluorescence assays to identify compounds affecting cell migration.

• Developmental biology: Tracking AVL9 expression during embryonic development and tissue morphogenesis.

How can researchers contribute to improving AVL9 antibody resources?

The scientific community can enhance AVL9 antibody resources through:

• Validation sharing: Publishing detailed antibody validation protocols and results.

• Database contributions: Submitting antibody validation data to repositories like Antibodypedia or Research Resource Identifiers (RRID).

• Alternative formats: Developing recombinant antibodies, nanobodies, or aptamers against AVL9.

• Application expansion: Testing AVL9 antibodies in emerging techniques like Proximity Ligation Assay (PLA) or CODEX multiplexed imaging.

• Cross-laboratory validation: Organizing multi-center studies to benchmark antibody performance across different settings.