BEND7 Antibody

Shipped with Ice Packs
In Stock

Description

Biological Role of BEND7

BEND7 is a 519-amino-acid protein containing a BEN domain, which facilitates protein-DNA and protein-protein interactions during chromatin organization and transcription . It is evolutionarily conserved and expressed in tissues such as the liver, testis, and germ cells . Key functional insights include:

  • Chromatin Regulation: BEND7 interacts with pluripotency factors (e.g., OCT4, SOX2) and promotes early germ cell differentiation in vitro, similar to its paralog BEND5 .

  • Metabolic Traits: Genome-wide studies link BEND7 to glycemic traits in the Indian population, where genetic variants near BEND7 act as expression quantitative trait loci (eQTLs) and methylation QTLs (meth-QTLs), influencing glucose metabolism genes .

  • Skin Pigmentation: A locus near BEND7 (rs6602666) is associated with skin color in African-admixed populations, highlighting its pleiotropic roles .

Germ Cell Differentiation

  • Overexpression of BEND5 (a BEND7 homolog) in mouse embryonic stem cells (mESCs) increases Stella-GFP and Blimp1-mVenus double-positive cells, indicating enhanced germ cell differentiation .

  • BEND7’s role in this process is inferred from its structural similarity and shared interaction partners .

Genetic and Epigenetic Regulation

  • In Indian populations, BEND7-associated variants correlate with fasting glucose and insulin levels, affecting genes like ZNF470 and DPP6 .

  • Co-localized eQTLs and meth-QTLs near BEND7 alter transcription factor binding sites, modulating glucose metabolism pathways .

Environmental Response

  • Rat studies show BEND7 expression is modulated by toxins (e.g., bisphenol A, silver nanoparticles) and pharmaceuticals (e.g., cyclosporin A) . For example:

    • Bisphenol A: Decreases BEND7 methylation and mRNA levels .

    • Silver Nanoparticles: Reduce BEND7 expression in mice but increase it in humans, suggesting species-specific responses .

Validation and Reproducibility

BEND7 antibodies are rigorously validated:

  • Enhanced Validation: Includes knockdown/knockout controls and orthogonal methods (e.g., ICC-IF and IHC) .

  • Western Blot: Detects BEND7 at ~55 kDa in mouse liver lysates .

  • IHC: Shows cytoplasmic localization in human liver tissue .

Limitations and Future Directions

  • Functional Insights: Most data on BEND7 are correlative; mechanistic studies are needed to clarify its role in chromatin and metabolism.

  • Antibody Specificity: Cross-reactivity with other BEN domain proteins remains a concern, necessitating careful experimental controls .

Product Specs

Buffer
Preservative: 0.03% Proclin 300; Constituents: 50% Glycerol, 0.01M PBS, pH 7.4
Form
Liquid
Lead Time
Orders are typically dispatched within 1-3 business days of receipt. Delivery times may vary depending on the shipping method and destination. Please contact your local distributor for precise delivery estimates.
Synonyms
BEND7 antibody; C10orf30 antibody; BEN domain-containing protein 7 antibody
Target Names
BEND7
Uniprot No.

Q&A

What is BEND7 and what cellular functions has it been associated with?

BEND7, also known as C10orf30 (Chromosome 10 open reading frame 30), is a protein containing the BEN domain. Recent research has identified BEND7 as a platelet-specific gene involved in immune regulation during sepsis . The protein has been observed localizing to multiple cellular compartments, including the nucleus, nucleoli fibrillar center, and vesicles in certain cell types . Through single-cell RNA sequencing analysis, researchers have documented strong interactions between BEND7-expressing platelets and immune cells, particularly monocytes and neutrophils, via intercellular adhesion molecule signaling pathways . This suggests BEND7 may play an important role in platelet-immune cell communication during inflammatory responses.

What validated applications exist for BEND7 antibodies in research?

BEND7 antibodies have been validated for multiple experimental applications, providing researchers with flexibility in studying this protein across different contexts:

ApplicationRecommended UsageNotes
Immunocytochemistry/Immunofluorescence0.25-2 μg/mlUse PFA/Triton X-100 for fixation/permeabilization
Immunohistochemistry1:20 - 1:50 dilution-
Immunohistochemistry-Paraffin1:20 - 1:50 dilutionHIER pH 6 retrieval recommended

The antibodies have demonstrated strong cytoplasmic positivity in hepatocytes when used for immunohistochemistry on human liver tissues, and localization to nucleus, nucleoli fibrillar center, and vesicles in the U-2 OS human cell line .

What are the critical parameters for successful BEND7 antibody staining in tissue sections?

For optimal BEND7 antibody staining in tissue sections, several methodological considerations are crucial:

  • Antigen retrieval method: For paraffin-embedded tissues, Heat-Induced Epitope Retrieval (HIER) at pH 6 is specifically recommended . This helps unmask epitopes that may be cross-linked during fixation.

  • Antibody concentration: A dilution range of 1:20 to 1:50 is recommended for immunohistochemistry applications . Researchers should optimize this range based on their specific tissue type and fixation protocol.

  • Fixation protocol: The choice of fixative can significantly impact epitope accessibility. For immunocytochemistry applications, paraformaldehyde fixation followed by Triton X-100 permeabilization is recommended .

  • Blocking strategy: While not explicitly stated in the search results, standard blocking protocols using serum or BSA (bovine serum albumin) are typically employed to minimize non-specific binding.

These parameters should be validated and potentially adjusted for each experimental system to ensure specific and reproducible staining patterns.

How can BEND7 antibodies be utilized to investigate its role in platelet function during sepsis?

Recent research has identified BEND7 as a platelet-specific gene involved in immune regulation during sepsis . To investigate this role, researchers can employ several advanced methodological approaches:

  • Co-immunoprecipitation studies: Using BEND7 antibodies to pull down associated protein complexes from activated platelets can help identify binding partners involved in immune signaling cascades. This approach can elucidate molecular mechanisms behind BEND7's role in platelet-immune cell communication.

  • Flow cytometry with platelet activation markers: Combining BEND7 antibody staining with platelet activation markers (like P-selectin or activated GPIIb/IIIa) can reveal associations between BEND7 expression levels and platelet activation states during septic conditions.

  • Intravital microscopy: Using fluorescently-labeled BEND7 antibodies in animal models of sepsis can visualize real-time BEND7-positive platelet interactions with immune cells, particularly monocytes and neutrophils which have shown strong communication with BEND7-expressing platelets .

  • Single-cell protein and RNA co-profiling: Integrating BEND7 antibody staining with single-cell RNA sequencing can map BEND7 protein expression to transcriptional states, potentially revealing subpopulations of platelets with distinct immunomodulatory functions.

These approaches can provide mechanistic insights into how BEND7-positive platelets participate in immune regulation during sepsis, potentially identifying new therapeutic targets.

What experimental design considerations are important when studying BEND7's subcellular localization?

The documented localization of BEND7 to multiple cellular compartments necessitates careful experimental design to accurately characterize its subcellular distribution:

  • Selection of complementary techniques: Combining immunofluorescence with subcellular fractionation followed by Western blotting provides orthogonal validation of localization patterns. This is particularly important given BEND7's reported presence in multiple compartments including the nucleus, nucleoli fibrillar center, and vesicles .

  • Co-localization with organelle markers: Simultaneous staining with established markers for nucleoli (nucleolin), nuclear speckles (SC35), and various vesicular compartments (Rab proteins) can precisely define BEND7's distribution pattern.

  • Super-resolution microscopy: Techniques like STORM, PALM, or SIM provide nanometer-scale resolution that can distinguish between closely positioned subcellular structures, offering more precise localization data than conventional confocal microscopy.

  • Live-cell imaging: Using GFP-tagged BEND7 constructs alongside the validation with antibodies can track dynamic changes in localization in response to cellular stimuli, potentially revealing functional insights.

  • Controls for antibody specificity: Given the complex localization pattern, rigorous controls including peptide competition, BEND7 knockdown cells, and comparison of multiple BEND7 antibodies targeting different epitopes are essential to confirm the specificity of observed staining patterns.

These methodological considerations help ensure that observed localization patterns accurately reflect BEND7's true biological distribution rather than technical artifacts.

How can researchers reconcile contradictory data regarding BEND7 function and expression?

When facing contradictory findings regarding BEND7 function or expression across different studies, researchers should implement systematic approaches to resolution:

  • Cell-type specific analysis: The apparent contradictions may reflect genuine biological differences between cell types. BEND7 functions primarily as a platelet-specific gene , but its expression has also been documented in hepatocytes and other cell types . Single-cell RNA sequencing and proteomics can help map expression patterns with high resolution across cell types.

  • Antibody validation protocol comparison: Different antibodies against BEND7 may recognize distinct epitopes or isoforms. Researchers should critically compare validation protocols used in contradictory studies, including:

    • Epitope mapping data

    • Knockout/knockdown validation

    • Cross-reactivity assessments

    • Different applications tested (WB vs. IHC vs. IF)

  • Experimental condition variables: Systematically evaluate how differences in key parameters affect results:

    • Sample preparation methods (fixation, permeabilization)

    • Antibody concentrations and incubation conditions

    • Detection systems utilized

  • Isoform-specific analysis: Determine if contradictions stem from differential expression or function of BEND7 isoforms. This may require isoform-specific antibodies or genetic approaches.

By systematically examining these variables, researchers can better understand whether contradictions represent technical artifacts or biologically meaningful differences in BEND7 behavior across contexts.

What are the optimal protocols for investigating BEND7-mediated cell-cell communication using antibody-based techniques?

Based on findings that BEND7-positive platelets interact with immune cells through intercellular adhesion molecule signaling , researchers interested in studying these interactions should consider these methodological approaches:

  • Proximity ligation assay (PLA): This technique can visualize protein-protein interactions between BEND7 and potential binding partners at interaction sites between platelets and immune cells with high sensitivity. PLA requires:

    • BEND7 antibodies raised in one species

    • Antibodies against potential interaction partners (e.g., adhesion molecules) raised in different species

    • Species-specific secondary antibodies conjugated to complementary oligonucleotides

  • Multi-color flow cytometry panels: Design panels that simultaneously detect:

    • BEND7 expression (using validated antibodies)

    • Cell type-specific markers (CD41 for platelets, CD14 for monocytes, CD15 for neutrophils)

    • Adhesion molecules (various ICAMs and their receptors)

    • Activation markers

  • Ex vivo co-culture systems with imaging:

    • Isolate platelets and immune cells from appropriate sources

    • Label with cell-tracking dyes and BEND7 antibodies

    • Monitor interactions using live-cell imaging

    • Quantify contact duration, frequency, and consequences

  • Functional blocking experiments: Use blocking antibodies against both BEND7 and identified adhesion molecules to determine the functional significance of these interactions for immune responses.

These approaches allow researchers to move beyond correlative observations to establish causal relationships between BEND7 expression and specific cell-cell communication events in immune regulation.

What are the critical factors affecting BEND7 antibody specificity and reproducibility?

Ensuring BEND7 antibody specificity requires attention to several key factors:

  • Antibody validation approach: The gold standard includes demonstrating loss of signal in BEND7 knockout or knockdown samples. Commercial BEND7 antibodies are typically validated through immunogen affinity purification and testing across multiple applications.

  • Epitope considerations: BEND7 antibodies may be raised against specific regions of the protein. For example, one commercial antibody targets a specific amino acid sequence (SILSNYTRSGSLLFRKLVCAFFDDKTLANSLPNGKRKRGLNDNRKGLDQNIVGAIKVFTEKYCTANHVDKLPGPRDWVQILQDQIK) , which should be considered when interpreting results, particularly if studying potential BEND7 isoforms.

  • Storage and handling: Proper aliquoting, storage at recommended temperatures (typically 4°C short-term or -20°C long-term), and avoiding freeze-thaw cycles are essential for maintaining antibody performance .

  • Batch-to-batch variation: Polyclonal antibodies against BEND7 may show batch variation. Researchers should:

    • Document lot numbers

    • Test new lots against previous ones before switching

    • Consider establishing an internal reference standard

  • Cross-reactivity assessment: While BEND7 antibodies show predicted reactivity with mouse (98%) and rat (99%) orthologs , experimental validation is recommended before using these antibodies across species.

Implementing these practices helps ensure that experimental results genuinely reflect BEND7 biology rather than technical artifacts.

How can researchers optimize BEND7 antibody performance for challenging sample types?

When working with challenging samples for BEND7 detection, consider these methodological optimizations:

  • For formalin-fixed paraffin-embedded (FFPE) tissues:

    • Extend antigen retrieval time beyond standard protocols

    • Test multiple retrieval buffers beyond the recommended pH 6

    • Consider enzymatic retrieval methods as alternatives

    • Use amplification systems like tyramide signal amplification for low-abundance detection

  • For samples with high background:

    • Increase blocking duration and concentration

    • Add blocking steps with both serum and commercially available background reducers

    • Test longer antibody incubation at lower concentrations

    • Include additional washing steps with varying salt concentrations

  • For dual/multi-label experiments:

    • Test sequential versus simultaneous antibody incubations

    • Validate that antibody combinations don't interfere with each other's binding

    • Consider direct conjugation of BEND7 antibodies to fluorophores to eliminate species cross-reactivity

  • For low-abundance detection:

    • Employ super-sensitive detection systems

    • Consider concentration of samples before analysis

    • Use proximity ligation assay approaches for signal amplification

    • Test signal enhancement reagents compatible with immunoassays

These optimizations can help overcome technical limitations when studying BEND7 in technically challenging contexts.

How can advances in antibody engineering be applied to improve BEND7 detection and functional studies?

Recent advances in antibody engineering, as highlighted in the DyAb research , offer promising approaches to enhance BEND7 antibody performance:

  • Affinity maturation strategies: The DyAb platform described in the search results demonstrates how combining beneficial mutations can significantly improve antibody binding affinity . For BEND7 research, similar approaches could:

    • Identify key residues affecting binding through alanine scanning

    • Combine beneficial mutations to generate higher-affinity variants

    • Use genetic algorithms to explore sequence space efficiently

  • Format optimization: Beyond traditional antibody formats, researchers could explore:

    • Single-domain antibodies for better tissue penetration

    • Bispecific formats targeting BEND7 and interacting partners simultaneously

    • Intrabodies for live-cell tracking of BEND7

  • Machine learning integration: The DyAb research demonstrates how protein language models can predict antibody properties from sequence data . Similar approaches could:

    • Predict optimal BEND7 epitopes for antibody generation

    • Optimize complementarity-determining regions (CDRs) for existing BEND7 antibodies

    • Guide rational design of antibodies with desired properties

  • Expression and developability improvements: The DyAb research achieved high expression rates (>85%) , demonstrating that engineered antibodies can maintain manufacturability. Similar engineering could create BEND7 antibodies with:

    • Improved stability in challenging conditions

    • Enhanced expression yields

    • Better specificity profiles

These advanced engineering approaches could address current limitations in BEND7 antibody technology, enabling more sensitive and specific detection methods.

How might BEND7 antibodies contribute to understanding its role as a potential therapeutic target in sepsis?

The identification of BEND7 as a platelet-specific gene involved in immune regulation during sepsis suggests several promising research directions utilizing BEND7 antibodies:

  • Development of diagnostic biomarkers: BEND7 antibodies could be employed to develop assays measuring BEND7 expression or activation state in platelets as potential biomarkers for sepsis progression or treatment response.

  • Therapeutic targeting strategies: Based on the sepsis association, researchers might explore:

    • Blocking antibodies that interfere with BEND7-mediated platelet-immune cell interactions

    • Internalization of BEND7 antibody-drug conjugates to target specific platelet subpopulations

    • Development of small molecule inhibitors guided by epitope mapping with BEND7 antibodies

  • Mechanistic studies: BEND7 antibodies can help elucidate:

    • The signaling pathways activated downstream of BEND7 in platelets during sepsis

    • How BEND7-positive platelets influence neutrophil and monocyte function

    • The role of BEND7 in other inflammatory conditions beyond sepsis

  • Validation in diverse sepsis models: Using BEND7 antibodies to track expression across:

    • Different sepsis etiologies (bacterial, viral, fungal)

    • Varying clinical severities

    • Treatment response patterns

These research directions could potentially lead to new therapeutic approaches targeting BEND7-positive platelets to modulate immune responses during sepsis .

What emerging technologies could enhance BEND7 antibody-based research?

Several cutting-edge technologies could significantly advance BEND7 antibody applications:

  • Spatial transcriptomics integration: Combining BEND7 antibody staining with spatial transcriptomics could:

    • Map BEND7 protein expression to local transcriptional environments

    • Reveal spatial relationships between BEND7-positive cells and their microenvironment

    • Identify potential regulatory factors controlling BEND7 expression

  • Antibody-based proximity labeling: Techniques like TurboID or APEX2 fused to BEND7 antibodies or fragments could:

    • Map the BEND7 proximal proteome in living cells

    • Identify transient interaction partners

    • Characterize the microenvironment of BEND7-containing complexes

  • Photoswitchable antibody technologies: Using photoactivatable BEND7 antibodies could enable:

    • Super-resolution imaging beyond conventional limits

    • Pulse-chase experiments tracking BEND7 dynamics

    • Optogenetic control of BEND7 functions

  • Single-cell proteomics integration: Combining BEND7 antibodies with emerging single-cell proteomics methods could:

    • Map co-expression patterns with hundreds of other proteins

    • Identify cell states associated with high BEND7 expression

    • Discover novel signaling networks involving BEND7

These technological frontiers represent promising directions for researchers seeking to gain deeper insights into BEND7 biology and function in health and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.