BQ2027_MB3645C Antibody

What is the BQ2027_MB3645C protein and what role does it play in mycobacterial research?

The BQ2027_MB3645C protein is an EspC protein homolog derived from Mycobacterium bovis strain AF2122/97 (Uniprot ID: P65088). It consists of 103 amino acids with the sequence MTENLTVQPERLGVLASHHDNAAVDASSGVEAAAGLGESVAITHGPYCSQFNDTLNVYLTAHNALGSSLHTAGVDLAKSLRIAAKIYSEADEAWRKAIDGLFT and has a molecular weight of approximately 16.3 kDa .

This protein is associated with the ESX-1 secretion system, which plays a critical role in mycobacterial virulence. EspC homologs are hypothesized to form needle-like structures involved in pathogen-host interactions, making it an important target for tuberculosis research. Studies evaluating recombinant EspC have demonstrated its ability to elicit strong IFN-γ responses and high IgG2a/IgG1 antibody ratios, indicating its potential in inducing robust Th1-polarized immune responses.

What applications is the BQ2027_MB3645C Antibody validated for?

While specific validation data for BQ2027_MB3645C Antibody varies by manufacturer, antibodies against this target are typically validated for several key applications in mycobacterial research:

When selecting an antibody for your research, consult antibody data repositories that share validation and experimental data to help determine if the antibody is suitable for your specific experimental conditions .

How should BQ2027_MB3645C Antibody be validated before use in critical experiments?

Following the guidelines of the International Working Group for Antibody Validation , researchers should employ at least two of these five "pillar" approaches when validating BQ2027_MB3645C Antibody:

• Genetic strategies: Testing antibody in knockout/knockdown models of M. bovis lacking BQ2027_MB3645C expression

• Orthogonal strategies: Comparing antibody-based measurements with antibody-independent methods (e.g., mass spectrometry)

• Independent antibody strategies: Using two different antibodies that recognize separate epitopes on BQ2027_MB3645C

• Expression of tagged proteins: Comparing detection of tagged recombinant BQ2027_MB3645C with the antibody detection pattern

• Immunocapture followed by mass spectrometry: Confirming that immunoprecipitation with the antibody pulls down BQ2027_MB3645C

These validation approaches help ensure experimental reproducibility and prevent non-specific or off-target antibody binding that could compromise research findings .

How does BQ2027_MB3645C contribute to mycobacterial pathogenicity mechanisms?

BQ2027_MB3645C (EspC protein homolog) is a component of the ESX-1 secretion system, which is critical for the virulence of pathogenic mycobacteria. This secretion system is hypothesized to act as a needle-like structure mediating pathogen-host interactions. The ESX-1 system facilitates:

• Phagosomal escape: Enabling mycobacteria to translocate from phagosomes to the cytosol of infected macrophages

• Immunomodulation: Altering host immune responses through secreted effector proteins

• Cell-to-cell spread: Facilitating bacterial dissemination within the host

Research indicates that EspC proteins like BQ2027_MB3645C elicit strong cellular immune responses. Studies in BALB/c mice demonstrated that recombinant EspC induced high IFN-γ production characteristic of Th1 responses, with high IgG2a/IgG1 antibody ratios. Moreover, EspC/EspB fusion proteins showed superior cross-reactivity and enhanced Th1 bias compared to individual proteins.

When designing experiments to investigate BQ2027_MB3645C's role in pathogenicity, researchers should consider comparative analyses between wild-type strains and those with mutations in the ESX-1 system components.

What challenges exist in expressing and purifying BQ2027_MB3645C for antibody production?

The recombinant expression of BQ2027_MB3645C presents several technical challenges requiring optimization strategies:

For example, EspA (a secretion system partner of EspC) required N-terminal GFP fusion to achieve detectable expression, highlighting the importance of optimizing expression systems when working with these challenging proteins.

When producing antibodies against BQ2027_MB3645C, these expression challenges may impact antigen quality and subsequent antibody specificity. Researchers should carefully evaluate the quality of the immunogen used for antibody production when selecting commercial antibodies.

How can researchers leverage computational biology approaches for designing better BQ2027_MB3645C antibodies?

Recent advances in computational antibody design can significantly improve antibody quality against targets like BQ2027_MB3645C:

• Structure-based design: Using high-resolution structural information of BQ2027_MB3645C to identify optimal epitopes for antibody targeting. Recent research demonstrates that accurate antibody loop structure prediction enables effective zero-shot design of target-binding antibody loops .

• AI-driven approaches: Pre-trained Antibody generative Large Language Models (like PALM-H3) can generate de novo antibody sequences with desired binding specificity, potentially creating higher-affinity binders against BQ2027_MB3645C .

• Epitope prediction: Employing computational tools to identify surface-exposed, conserved regions of BQ2027_MB3645C that may serve as ideal antibody targets.

Evaluation metrics for computationally designed antibodies typically include:

• Structure recovery rate (percentage where designed structures maintain <2Å RMSD from experimental structures)

• G-pass rate (incorporating confidence and consistency scores)

• In vitro binding assays (to confirm computational predictions)

The most recent antibody design models have achieved in vitro success rates of 5-15% for designed antibodies showing detectable binding, with some achieving sub-nanomolar affinities .

What controls should be included when using BQ2027_MB3645C Antibody in immunoblotting experiments?

When designing immunoblotting experiments with BQ2027_MB3645C Antibody, include these essential controls:

• Positive control: Recombinant BQ2027_MB3645C protein with N-terminal 10xHis-tag expressed in E. coli. This verifies antibody functionality .

• Negative controls:

  • Lysates from non-mycobacterial species to verify specificity

  • Mycobacterial species lacking ESX-1 secretion system components

  • Pre-immune serum (for polyclonal antibodies) or isotype control (for monoclonals)

• Loading control: Anti-GroEL or other constitutively expressed mycobacterial proteins to normalize protein loading

• Peptide competition: Pre-incubating antibody with excess BQ2027_MB3645C peptide should abolish specific signal

• Molecular weight verification: BQ2027_MB3645C should appear at approximately 16.3 kDa; any additional bands may indicate degradation products or cross-reactivity

How should experiments be designed to study BQ2027_MB3645C's interactions with other ESX-1 components?

When investigating BQ2027_MB3645C's interactions with other ESX-1 components, consider this experimental workflow:

• Co-immunoprecipitation (Co-IP):

  • Use BQ2027_MB3645C Antibody as the bait antibody to pull down protein complexes

  • Analyze precipitated proteins by mass spectrometry or western blotting for known ESX-1 components

  • Include appropriate controls: IgG isotype control, lysates from ESX-1-deficient strains

• Proximity labeling approaches:

  • Express BQ2027_MB3645C fused to BioID or APEX2 proximity labeling enzymes

  • Identify proteins in close proximity using streptavidin pulldown and mass spectrometry

  • Validate interactions using reciprocal Co-IP experiments

• Structural analysis:

  • Utilize cryo-EM to visualize the three-dimensional organization of the ESX-1 complex

  • Based on structural models, single amino acid mutations can be introduced to disrupt specific interactions

  • Functional assays can then determine how these disruptions affect ESX-1 function

Interestingly, researchers have developed a model showing how multiple antibodies can bind simultaneously to the spike protein of SARS-CoV-2 in a non-overlapping fashion , which could provide insights for similar approaches to study ESX-1 protein complexes using multiple non-competing antibodies against different components.

What methodologies are recommended for studying BQ2027_MB3645C expression during different phases of mycobacterial infection?

To study BQ2027_MB3645C expression dynamics during infection, employ these complementary approaches:

• Quantitative time-course analysis:

  • Infect macrophage cell lines or primary cells with M. bovis

  • Harvest bacteria at defined timepoints (0h, 6h, 24h, 48h, 72h post-infection)

  • Perform quantitative RT-PCR for BQ2027_MB3645C mRNA

  • Parallel analysis using western blotting with BQ2027_MB3645C Antibody

  • Use housekeeping genes (16S rRNA, sigA) for normalization

• In situ detection during infection:

  • Perform immunofluorescence microscopy of infected cells using BQ2027_MB3645C Antibody

  • Co-stain with markers for different intracellular compartments

  • Analyze subcellular localization in relation to bacterial escape from phagosomes

• Animal model time-course studies:

  • Isolate bacteria from infected tissues at different stages of infection

  • Analyze protein expression by western blotting

  • Perform immunohistochemistry on tissue sections to visualize BQ2027_MB3645C expression in situ

When interpreting results, consider that BQ2027_MB3645C expression may be regulated in response to environmental cues such as pH, oxygen limitation, and nutrient availability within the host. Data should be analyzed in context with other ESX-1 components to understand the coordinated expression of this secretion system.

What strategies can address inconsistent results when using BQ2027_MB3645C Antibody?

When facing inconsistent results with BQ2027_MB3645C Antibody, systematically address these common issues:

Additional considerations specific to mycobacterial proteins:

• The cell wall complexity of mycobacteria may require specialized lysis buffers containing detergents like Triton X-100 or SDS

• Mechanical disruption methods (bead-beating, sonication) may improve protein extraction

• Fixation methods for immunofluorescence should be optimized as overfixation may mask epitopes

Consider adopting the five "pillars" of antibody validation mentioned in question 1.3 to systematically verify antibody performance in your specific experimental setup .

How can BQ2027_MB3645C Antibody be used in multiplexed detection systems with other ESX-1 components?

For multiplexed detection of BQ2027_MB3645C alongside other ESX-1 components:

• Multicolor immunofluorescence microscopy:

  • Use primary antibodies from different host species (e.g., rabbit anti-BQ2027_MB3645C with mouse anti-EspA)

  • Detect with species-specific secondary antibodies conjugated to different fluorophores

  • Include appropriate controls to rule out cross-reactivity and spectral overlap

• Multiplex western blotting techniques:

  • Sequential immunoblotting with stripping between antibodies

  • Simultaneous detection using differently sized proteins with same-species antibodies

  • Fluorescent secondary antibodies with distinct emission spectra

• Multiplex flow cytometry:

  • Differential labeling of antibodies with distinct fluorophores

  • Permeabilization protocols must be optimized for intracellular mycobacterial proteins

  • Include single-stain controls for compensation settings

When developing multiplex assays, consider the principles applied in the REGEN-COV antibody combination, which uses non-competing antibodies targeting different epitopes to provide more robust detection and prevent escape variants in SARS-CoV-2 . Similar principles can be applied to detect multiple ESX-1 components simultaneously.

What considerations are important when designing experiments to study BQ2027_MB3645C variants across mycobacterial species?

When studying BQ2027_MB3645C variants across mycobacterial species, consider these methodological approaches:

• Sequence analysis and epitope mapping:

  • Perform multiple sequence alignment of EspC homologs across species

  • Identify conserved and variable regions

  • Determine if antibody epitopes fall within conserved regions (for cross-reactivity) or variable regions (for specificity)

• Cross-reactivity testing panel:

  • Test BQ2027_MB3645C Antibody against purified recombinant EspC homologs from different species

  • Include closely related species (M. tuberculosis, M. bovis, M. africanum) and more distant relatives

  • Validate cross-reactivity in whole cell lysates using western blotting

• Functional conservation assessment:

  • Compare immunogenicity profiles of EspC variants using similar methodology to studies showing that EspC elicits high IFN-γ responses

  • Evaluate differences in cellular localization of variants using immunofluorescence microscopy

  • Assess impact of sequence variations on protein-protein interactions within the ESX-1 system

This approach mirrors strategies used to study SARS-CoV-2 variants, where researchers evaluated how mutations impacted antibody binding . The REGEN-COV antibody combination maintained effectiveness against variants by targeting conserved epitopes, demonstrating the importance of epitope selection when studying variant proteins .

How can researchers leverage BQ2027_MB3645C Antibody in developing immunoassays for tuberculosis diagnostics?

When developing BQ2027_MB3645C-based immunoassays for TB diagnostics:

• Assay format selection and optimization:

  • ELISA: Optimize coating concentration of capture antibody (typically 1-10 μg/ml)

  • Lateral flow: Determine appropriate antibody pairs (capture and detection)

  • Multiplex bead arrays: Conjugate antibody to uniquely identifiable beads

• Clinical sample considerations:

  • Determine optimal sample types (serum, sputum, urine)

  • Develop appropriate sample processing to maximize sensitivity

  • Include concentration/purification steps for low-abundance antigens

• Validation against gold standards:

  • Compare performance against established TB diagnostic methods

  • Calculate sensitivity, specificity, positive and negative predictive values

  • Determine limit of detection and quantitative range

• Cross-reactivity assessment:

  • Test against samples from patients with other mycobacterial infections

  • Evaluate potential interference from comorbidities (HIV, non-tuberculous infections)