CABLES1 Antibody

What is CABLES1 and why is it significant in experimental research?

CABLES1 is a Cdk-interacting protein that binds to multiple Cdks including Cdk2, Cdk3, and Cdk5, acting as a negative regulator of cell proliferation. It functions by enhancing the inhibitory phosphorylation of Cdk2 mediated by Wee1 and stabilizing the cyclin-dependent kinase inhibitor p21Cip/waf . CABLES1 also interacts with and stabilizes members of the p53 family including p53, p73, and TAp63α, contributing to cell death pathways . Its significance stems from its frequent loss in multiple cancer types including colorectal, lung, ovarian, and endometrial cancers, establishing it as a candidate tumor suppressor gene . In experimental models, Cables1-/- mice show increased incidence of endometrial cancer and enhanced tumor progression in the ApcMin/+ mouse model of intestinal adenocarcinoma, confirming its tumor suppressor role in vivo .

Which applications are CABLES1 antibodies most commonly used for in research settings?

CABLES1 antibodies are utilized across multiple experimental applications:

Researchers should select antibodies that have been validated for their specific application of interest, as performance may vary significantly between applications .

What species reactivity should researchers consider when selecting a CABLES1 antibody?

Commercial CABLES1 antibodies demonstrate various cross-reactivity profiles that researchers should carefully evaluate based on their experimental model:

Most available polyclonal antibodies against CABLES1 show reactivity with human, mouse, and rat samples, making them suitable for comparative studies across these common research models . Some antibodies display broader cross-reactivity, recognizing CABLES1 from diverse species including cow, dog, guinea pig, horse, rabbit, and zebrafish . This extensive cross-reactivity is particularly valuable for evolutionary or comparative studies.

When selecting an antibody, researchers should verify the exact amino acid sequence used as the immunogen and its conservation across species of interest. Antibodies targeting the C-terminal region of CABLES1 tend to show broader cross-reactivity due to higher sequence conservation in this region . Before committing to extensive experiments, validation in your specific species model is strongly recommended, especially when working with less common research organisms.

How do you validate the specificity of a CABLES1 antibody in experimental settings?

Comprehensive validation of CABLES1 antibodies should follow these methodological steps:

• Genetic controls: Use Cables1 knockout (Cables1-/-) cells or tissues as negative controls. The complete absence of signal in these samples confirms antibody specificity .

• Overexpression controls: In parallel, use cells overexpressing CABLES1 (via transfection or transduction) to verify detection of increased protein levels . This is particularly important when working with antibodies that recognize post-translational modifications.

• siRNA/shRNA knockdown: Implement RNA interference to reduce CABLES1 expression and confirm corresponding reduction in antibody signal. This approach is demonstrated in studies using shRNA against CABLES1 in CD34+ cells .

• Molecular weight verification: CABLES1 should be detected at its expected molecular weight (~68 kDa). Multiple bands may indicate detection of isoforms, degradation products, or non-specific binding .

• Peptide competition: Pre-incubation of the antibody with the immunizing peptide should abolish specific signals in Western blot or immunostaining applications.

Rigorous validation is particularly crucial when studying CABLES1 in cancer contexts, where expression might be significantly altered compared to normal tissues .

What methodological approaches are effective for studying CABLES1-p21 interactions?

To effectively investigate CABLES1-p21 interactions, researchers should employ multiple complementary techniques:

• Co-immunoprecipitation (Co-IP): This remains the gold standard for demonstrating physical interaction. Use CABLES1 antibodies to immunoprecipitate the protein complex and then probe for p21, or vice versa. Studies have shown that CABLES1 regulates p21 protein levels, making this interaction biologically significant .

• Western blot analysis: To quantify the effect of CABLES1 on p21 protein levels, compare p21 expression in systems with modified CABLES1 expression. Research demonstrates that CABLES1 overexpression increases p21 protein levels, while CABLES1 knockdown via shRNA reduces p21 levels without affecting p21 mRNA expression .

• Protein stability assays: Use cycloheximide chase experiments to assess whether CABLES1 affects p21 protein stability or turnover. This is particularly important as CABLES1 has been shown to stabilize p21 .

• Cellular models: Utilize both CABLES1 overexpression systems and CABLES1 knockdown/knockout models to examine bidirectional effects on p21 regulation. This approach revealed decreased p21 protein levels in Cables1-/- LSK and LSK SLAM cells compared to wild-type counterparts .

• Cytokine stimulation: Assess how growth factor stimulation affects both CABLES1 and p21 expression simultaneously. Studies show that cytokine stimulation of CD34+ cells leads to decreased CABLES1 expression accompanied by parallel reduction in p21 protein levels .

These methodologies provide complementary insights into the mechanistic relationship between CABLES1 and p21, which appears to be primarily post-transcriptional in nature .

How can researchers optimize detection of CABLES1 in hematopoietic stem cells?

Optimizing CABLES1 detection in hematopoietic stem cells (HSCs) requires attention to several technical considerations:

• Cell sorting strategy: HSCs represent a rare population requiring precise isolation. Use fluorescence-activated cell sorting (FACS) to isolate Lin-Sca-1+c-Kit+ (LSK) cells and further refine to CD150+CD48- (SLAM) phenotype to enrich for long-term HSCs as demonstrated in studies of Cables1-/- mice .

• Sample preparation: Due to limited cell numbers, optimize protein extraction to maximize yield while maintaining protein integrity. Rapid lysis and processing are essential as CABLES1 may be subject to degradation.

• Detection sensitivity: Use enhanced chemiluminescence or fluorescence-based Western blot systems to maximize sensitivity. Studies have successfully detected CABLES1 and p21 protein levels in murine LSK and LSK SLAM cells despite their rarity .

• Antibody selection: For examining CABLES1 in HSCs, select antibodies validated in hematopoietic cell types and capable of detecting potentially lower expression levels. Polyclonal antibodies may offer greater sensitivity by recognizing multiple epitopes .

• Controls: Include both positive controls (cell lines with known CABLES1 expression) and negative controls (Cables1-/- HSCs if available). This is particularly important when working with rare cell populations where background signals may complicate interpretation .

• Functional correlation: Correlate CABLES1 expression with HSC functional characteristics such as quiescence, proliferation, and stress response, as Cables1-/- mice display hyperproliferation of hematopoietic progenitor cells, suggesting its role in maintaining HSC homeostasis .

Researchers should note that CABLES1 expression decreases upon cytokine stimulation in CD34+ cells, which may affect detection depending on the activation state of the HSCs being studied .

What strategies can differentiate between phosphorylated and non-phosphorylated CABLES1?

Distinguishing between phosphorylated and non-phosphorylated forms of CABLES1 requires specialized approaches:

• Phospho-specific antibodies: Utilize antibodies specifically recognizing phosphorylated residues of CABLES1. Research has employed antibodies against phosphorylated CABLES1 at threonine residues T44 and T150 . These phospho-specific antibodies are critical for studying CABLES1 regulation by kinases such as Akt.

• Phosphatase treatment controls: Treat sample aliquots with lambda phosphatase before immunoblotting to verify phosphorylation-dependent signals. The signal should disappear in phosphatase-treated samples when using phospho-specific antibodies.

• Mobility shift analysis: Phosphorylated proteins often migrate differently during SDS-PAGE. The use of Phos-tag acrylamide gels can enhance separation of phosphorylated from non-phosphorylated CABLES1.

• Kinase inhibitor studies: Treat cells with specific kinase inhibitors (such as Akt inhibitors) before analysis to determine which signaling pathways regulate CABLES1 phosphorylation . Studies have shown that CABLES1 can be regulated by survival signaling pathways.

• Mass spectrometry: For unbiased identification of phosphorylation sites, immunoprecipitate CABLES1 and analyze by mass spectrometry. This approach can identify novel phosphorylation sites beyond the established T44 and T150 residues .

• Phosphomimetic mutants: Create CABLES1 constructs with phosphomimetic mutations (S/T to D/E) or phospho-dead mutations (S/T to A) to study the functional consequences of phosphorylation at specific residues in cellular assays.

Research has established that CABLES1 phosphorylation status affects its stability and function, making these differentiation strategies essential for mechanistic studies .

How can CABLES1 antibodies be used to study its tumor suppressor function?

Investigating CABLES1's tumor suppressor function using antibodies requires multifaceted experimental approaches:

• Expression analysis in clinical samples: Use CABLES1 antibodies for immunohistochemistry to compare expression between normal and tumor tissues. Loss of CABLES1 expression has been observed with high frequency in human colon, lung, ovarian, and endometrial cancers . Quantitative analysis of staining intensity and subcellular localization can provide insights into its clinical significance.

• Cell proliferation assays: After manipulating CABLES1 expression (overexpression or knockdown), use antibodies to confirm expression changes before assessing proliferation rates. Studies in CD34+ cells demonstrated that CABLES1 overexpression reduced both the number and size of colonies in methylcellulose assays .

• Cell cycle analysis: Combine CABLES1 immunostaining with cell cycle markers to investigate its role in cell cycle regulation. CABLES1 inhibits proliferation in cell line models by enhancing the inhibitory function of Cdk2 mediated by Wee1 .

• Signaling pathway interaction: Use CABLES1 antibodies in co-immunoprecipitation experiments to identify interactions with other tumor suppressors or oncogenic proteins. CABLES1 has been shown to interact with p53 family members including p53, p73, and TAp63α .

• β-catenin pathway analysis: Employ dual immunostaining for CABLES1 and β-catenin to study their relationship, as tumors from Cables1-/- ApcMin/+ mice show increased nuclear expression of β-catenin, indicating CABLES1 may suppress Wnt/β-catenin signaling .

• Mouse model investigations: Analyze tissues from wild-type and Cables1-/- mice to understand tissue-specific tumor suppressor functions. Cables1 loss enhances intestinal tumor progression in ApcMin/+ mice, with tumors showing increased PCNA-positive cells indicating higher proliferation rates .

These approaches collectively provide mechanistic insights into how CABLES1 functions as a tumor suppressor in different cellular contexts and cancer types.

How can researchers troubleshoot inconsistent CABLES1 detection in Western blotting?

When encountering inconsistent CABLES1 detection in Western blotting, consider these methodological adjustments:

• Sample preparation optimization:

  • Use fresh samples whenever possible, as CABLES1 may be subject to degradation

  • Include protease inhibitors (complete cocktail) and phosphatase inhibitors in lysis buffers

  • Maintain samples at 4°C throughout processing to minimize protein degradation

  • Consider using RIPA buffer with 0.1% SDS for more efficient extraction of nuclear proteins like CABLES1

• Protein loading considerations:

  • Increase protein loading (50-100 μg per lane) as CABLES1 may be expressed at low levels in some cell types

  • Verify equal loading using multiple housekeeping controls (β-actin, Hsp90) as demonstrated in published protocols

  • Use stain-free gel technology for total protein normalization as an alternative to housekeeping genes

• Transfer optimization:

  • For this higher molecular weight protein (~68 kDa), extend transfer time or use stronger current

  • Consider using PVDF membranes (0.45 μm pore size) rather than nitrocellulose for better protein retention

  • Add 0.1% SDS to transfer buffer to enhance transfer efficiency of larger proteins

• Antibody optimization:

  • Test multiple antibodies targeting different epitopes of CABLES1

  • Optimize primary antibody concentration (typically 1:500 to 1:2000 dilution)

  • Extend primary antibody incubation to overnight at 4°C to improve sensitivity

  • Use 5% BSA instead of milk for blocking and antibody dilution, particularly for phospho-specific detection

• Signal detection:

  • Use enhanced chemiluminescence reagents designed for high sensitivity

  • Increase exposure time incrementally when using film

  • With digital imaging systems, optimize integration time to capture weak signals

If inconsistent results persist, consider validating antibody performance with positive controls (cells transfected with CABLES1 expression plasmids) and negative controls (CABLES1 knockdown or knockout samples) .

What controls are essential when studying CABLES1 in knockout or knockdown models?

Rigorous experimental design for CABLES1 knockout/knockdown studies requires comprehensive controls:

• Genetic model validation controls:

  • Confirm knockout or knockdown efficiency at both mRNA level (RT-qPCR) and protein level (Western blot)

  • For knockout models, sequence verification of the targeted locus is recommended

  • For knockdown models, use multiple siRNA/shRNA sequences targeting different regions of CABLES1 mRNA to control for off-target effects. Studies have successfully used shRNA to reduce CABLES1 expression in CD34+ cells

• Experimental controls:

  • Include wild-type (Cables1+/+) samples as positive controls

  • For knockdown experiments, include non-targeting shRNA/siRNA controls

  • For rescue experiments, reintroduce CABLES1 expression to verify phenotype reversibility

  • Include heterozygous (Cables1+/-) samples when available to assess gene dosage effects

• Pathway controls:

  • Monitor p21 protein levels, as CABLES1 regulates p21 stability

  • Assess Cdk2 Y15 phosphorylation to verify functional consequences of CABLES1 loss

  • Examine β-catenin nuclear localization, as CABLES1 affects Wnt signaling

  • For hematopoietic studies, examine progenitor cell proliferation rates as a functional readout

• Phenotypic validation controls:

  • For cancer-related studies, correlate CABLES1 status with PCNA expression for proliferation assessment

  • For stress response studies, include 5-fluorouracil treatment to assess differential sensitivity

  • For aging studies, compare young and aged animals to distinguish age-dependent effects

These controls ensure that observed phenotypes are specifically attributed to CABLES1 loss rather than experimental artifacts or compensatory mechanisms, as demonstrated in multiple Cables1-/- studies .

How do fixation techniques affect CABLES1 epitope recognition in immunohistochemistry?

Fixation methods significantly impact CABLES1 detection in immunohistochemical applications:

• Paraformaldehyde fixation (4% PFA):

  • Generally preserves CABLES1 epitopes with minimal masking

  • Recommended fixation time: 24-48 hours at room temperature

  • Cross-linking can sometimes mask epitopes, particularly those in the N-terminal region

  • Epitope retrieval using citrate buffer (pH 6.0) typically restores antibody accessibility

• Formalin fixation:

  • Commonly used in clinical samples but may require more rigorous antigen retrieval

  • Extended fixation (>48 hours) may reduce antibody binding to CABLES1

  • High-temperature antigen retrieval (95-100°C) for 20-30 minutes in Tris-EDTA buffer (pH 9.0) is often effective

  • Commercial antibodies targeting the C-terminal region of CABLES1 tend to perform better with formalin-fixed samples

• Frozen section preparation:

  • Optimal for preserving CABLES1 epitopes without chemical cross-linking

  • Brief fixation in cold acetone (10 minutes) may improve section adherence while maintaining antigenicity

  • Particularly useful for detecting phosphorylated forms of CABLES1, which are more sensitive to fixation artifacts

  • Some CABLES1 antibodies are specifically validated for detection in frozen sections

• Methanol fixation:

  • Provides good nuclear antigen preservation with less cross-linking

  • May be superior for detecting nuclear CABLES1 when studying its interactions with transcription factors

  • Brief fixation (10 minutes) at -20°C is typically sufficient

• Epitope retrieval optimization:

  • Test multiple retrieval methods (citrate, EDTA, enzymatic) when working with new tissue types

  • For heavily fixed archival samples, extended retrieval times (30-40 minutes) may be necessary

  • Dual antigen retrieval (heat followed by enzymatic) can significantly improve CABLES1 detection in challenging samples

The choice of fixation should be guided by the specific CABLES1 epitope targeted by the antibody and the downstream applications, with antibodies targeting the C-terminal region generally showing greater tolerance to various fixation methods .

How can CABLES1 antibodies support cancer research and biomarker development?

CABLES1 antibodies serve multiple critical functions in cancer research and biomarker development:

• Expression profiling across cancer types:

  • Immunohistochemical studies reveal CABLES1 loss in multiple tumor types including colorectal, lung, ovarian, and endometrial cancers

  • CABLES1 antibodies enable high-throughput tissue microarray screening to identify cancer types with frequent CABLES1 alterations

  • Quantitative scoring systems can correlate CABLES1 expression levels with clinical outcomes

• Tumor suppressor mechanism elucidation:

  • Western blot analysis of CABLES1 in conjunction with cell cycle regulators provides mechanistic insights

  • CABLES1 overexpression reduces colony number and size in methylcellulose assays, confirming its growth-inhibitory function

  • Co-immunoprecipitation reveals CABLES1 interactions with tumor suppressors like p53 and p73

• Wnt/β-catenin pathway interactions:

  • Dual immunostaining for CABLES1 and β-catenin shows increased nuclear β-catenin in Cables1-deficient tumors

  • CABLES1 antibodies help elucidate how this protein suppresses colorectal carcinogenesis through Wnt pathway inhibition

  • The ApcMin/+ Cables1-/- mouse model demonstrates significantly more intestinal tumors than ApcMin/+ Cables1+/+ mice, confirming CABLES1's tumor suppressor role in vivo

• Predictive biomarker development:

  • Standardized immunohistochemistry protocols can assess CABLES1 status in patient samples

  • Correlating CABLES1 expression with treatment responses may identify patient subgroups more likely to benefit from specific therapies

  • Combined analysis with other markers (p21, PCNA) may improve predictive power

• Therapeutic target identification:

  • Antibody-based screening can identify compounds that restore CABLES1 expression in cancer cells

  • Validation of drug effects on CABLES1 protein stability and function

  • Monitoring changes in CABLES1 phosphorylation status in response to kinase inhibitors

These applications collectively demonstrate how CABLES1 antibodies contribute to understanding cancer biology and developing potential diagnostic or prognostic tools based on this tumor suppressor.

What approaches can distinguish between CABLES1 isoforms in tissue samples?

Distinguishing between CABLES1 isoforms requires specialized experimental strategies:

• Epitope-specific antibody selection:

  • Use antibodies targeting regions unique to specific isoforms

  • N-terminal antibodies detect full-length CABLES1 but may miss truncated isoforms

  • C-terminal antibodies (like ABIN2789955) recognize the conserved C-terminal region present in multiple isoforms

  • Antibodies targeting the amino acid sequence PSYMTTVIDYVKPSDLKKDMNETFKEKFPHIKLTLSKIRSLKREMRKLAQ can detect C-terminal fragments

• Western blot analysis:

  • Use high-resolution SDS-PAGE (8-10% gels) to separate isoforms by molecular weight

  • Include positive controls expressing known CABLES1 variants

  • Extended gel running time improves separation of closely sized isoforms

  • Gradient gels (4-20%) may provide better resolution of multiple isoforms

• Immunoprecipitation followed by mass spectrometry:

  • Immunoprecipitate CABLES1 using a pan-CABLES1 antibody

  • Analyze by mass spectrometry to identify specific isoforms present

  • Compare peptide coverage maps to theoretical isoform sequences

• Isoform-specific PCR validation:

  • Design primers spanning exon-exon junctions unique to specific isoforms

  • Correlate protein detection with mRNA expression of specific variants

  • Use this information to interpret antibody detection patterns

• Differential subcellular localization:

  • Some CABLES1 isoforms may show distinct subcellular distribution

  • Immunofluorescence with carefully selected antibodies can reveal localization differences

  • Nuclear vs. cytoplasmic fractionation followed by Western blotting provides quantitative assessment

• Functional validation:

  • Correlate isoform detection with functional readouts (e.g., p21 levels, Cdk2 phosphorylation)

  • Overexpress specific isoforms and compare their effects on cell proliferation

  • Use isoform-specific knockdown to determine their relative contributions to CABLES1 functions

When reporting research findings, clearly specify which CABLES1 isoform(s) are being detected based on the antibody specifications and observed molecular weights to avoid confusion in the literature.

How might emerging technologies enhance CABLES1 detection and functional analysis?

Emerging technologies offer new opportunities for CABLES1 research with enhanced precision and insight:

• Single-cell protein analysis:

  • Mass cytometry (CyTOF) with metal-conjugated CABLES1 antibodies enables simultaneous detection of CABLES1 and dozens of other proteins at single-cell resolution

  • This approach is particularly valuable for heterogeneous populations like hematopoietic stem cells, where CABLES1 functions as a key regulator

  • Single-cell Western technologies allow protein expression profiling in rare cell populations

• Proximity labeling approaches:

  • BioID or APEX2 fusion with CABLES1 enables proximity-dependent biotinylation of interacting proteins

  • This method can identify previously unknown CABLES1 binding partners beyond established interactions with Cdks, p21, and p53 family members

  • Spatial proteomics applications reveal subcellular compartment-specific interactions

• Live-cell imaging of CABLES1 dynamics:

  • CRISPR-mediated endogenous tagging of CABLES1 with fluorescent proteins

  • This enables real-time visualization of CABLES1 localization and dynamics during cell cycle progression

  • FRET-based biosensors can monitor CABLES1-protein interactions in living cells

• High-throughput screening applications:

  • Cell-based assays using CABLES1 reporter systems to identify compounds that restore expression in cancer models

  • CRISPR activation screens to identify transcriptional regulators of CABLES1

  • Small molecule screens for compounds that stabilize CABLES1 protein or enhance its tumor suppressor functions

• In vivo imaging of CABLES1 status:

  • Development of CABLES1-targeted probes for non-invasive imaging

  • Monitoring CABLES1 expression dynamics during tumor development and treatment response

  • Correlating CABLES1 status with treatment outcomes in preclinical models

• Spatial transcriptomics and proteomics:

  • Combining CABLES1 antibody staining with spatial transcriptomics to correlate protein expression with local transcriptional programs

  • This is particularly relevant for understanding CABLES1's role in the bone marrow niche, where it influences hematopoietic stem cell quiescence

These technological advances will enable more comprehensive understanding of CABLES1 biology, potentially revealing new therapeutic strategies targeting this tumor suppressor pathway.

What are the key experimental considerations for investigating CABLES1 in stem cell biology?

Studying CABLES1 in stem cell contexts requires specialized experimental considerations:

• Hematopoietic stem cell isolation strategies:

  • Use multiparameter flow cytometry with lineage depletion followed by positive selection for stem cell markers

  • For murine studies, the LSK SLAM (Lin-Sca-1+c-Kit+CD150+CD48-) phenotype enriches for long-term HSCs

  • For human studies, CD34+CD38-CD90+CD45RA- phenotype identifies HSC-enriched populations

• Quiescence and cell cycle analysis:

  • CABLES1 is critical for maintaining HSC quiescence, as Cables1-/- mice display hyperproliferation of hematopoietic progenitor cells

  • Combine CABLES1 detection with quiescence markers (Ki-67, Hoechst/Pyronin Y staining)

  • Assess cell cycle distribution after modulating CABLES1 expression

• Stress response models:

  • 5-fluorouracil (5-FU) treatment challenges HSC populations and reveals defects in stress hematopoiesis

  • Cables1-/- mice show increased sensitivity to 5-FU due to abnormal microenvironment

  • Serial 5-FU administration can assess HSC self-renewal capacity in relation to CABLES1 status

• Aging models:

  • Aged Cables1-/- mice display abnormalities in peripheral blood counts and significant reduction in HSC compartment

  • Compare young and aged animals to distinguish age-dependent effects

  • Serial transplantation experiments assess HSC functional exhaustion in relation to CABLES1

• Stem cell niche interactions:

  • Co-culture experiments with wild-type or Cables1-/- stromal cells can dissect cell-intrinsic vs. niche effects

  • Cables1-/- mice have an abnormal microenvironment affecting hematopoiesis

  • Transplantation assays using wild-type recipients can isolate cell-intrinsic CABLES1 effects

• p21 connection assessment:

  • CABLES1 regulates p21 levels, which is critical for HSC maintenance

  • Measure p21 protein levels in conjunction with CABLES1 in stem cell populations

  • CABLES1 overexpression increases p21 levels, while CABLES1 knockdown reduces p21 in CD34+ cells

These specialized approaches account for the unique challenges of studying CABLES1 in rare stem cell populations while providing mechanistic insights into its role in stem cell homeostasis, aging, and stress response.