CACNA2D4 Antibody

Shipped with Ice Packs
In Stock

Description

  • Western Blot: Detects ~130 kDa bands in rat dorsal root ganglia (DRG) and PC12 cell lysates .

  • Immunohistochemistry: Labels CACNA2D4 in DRG neurons and C6 glioma cells .

  • Live-Cell Surface Staining: Validates membrane localization in intact cells .

Species Reactivity: Rat, mouse. Not recommended for human samples .

Retinal Dysfunction Mechanisms

CACNA2D4 knockout zebrafish models revealed:

  • Reduced expression of Cav1.4 (Cacna1fa) in photoreceptors .

  • Impaired cone-mediated ERG b-wave amplitudes in double paralog knockouts .

  • Increased "floating" synaptic ribbons and ectopic Cacna1fa localization .

These findings align with human studies linking CACNA2D4 mutations to cone-rod dystrophies .

Epileptogenesis and Calcium Channelopathy

CACNA2D4 is transcriptionally regulated by Egr1, a proepileptogenic factor. Overexpression of Cacna2d4 in murine models increased seizure susceptibility, suggesting its role in calcium channelopathies .

Biomarker Discovery

  • Whole-exome sequencing identified CACNA2D4 deletions in retinal degeneration cases .

  • Epigenetic studies linked CACNA2D4 to health outcomes in maltreatment survivors .

Technical Considerations for Antibody Use

  • Blocking Controls: Preincubation with immunizing peptide (e.g., #BLP-CC104) eliminates nonspecific signals .

  • Tissue-Specificity: Strongest signals observed in endocrine and neuronal tissues .

  • Limitations: Limited cross-reactivity with human CACNA2D4 due to sequence divergence .

Future Directions

CACNA2D4 antibodies are critical for:

  • Elucidating calcium channel trafficking mechanisms in photoreceptors .

  • Developing gene therapies for retinal dystrophies .

  • Investigating synaptic plasticity in neurological disorders .

Product Specs

Buffer
The antibody is provided as a liquid solution in phosphate buffered saline (PBS) containing 50% glycerol, 0.5% bovine serum albumin (BSA), and 0.02% sodium azide.
Form
Liquid
Lead Time
Typically, we can ship your order within 1-3 business days of receiving it. Delivery times may vary depending on the shipping method and location. Please consult your local distributor for specific delivery time estimates.
Synonyms
CACNA2D4Voltage-dependent calcium channel subunit alpha-2/delta-4 antibody; Voltage-gated calcium channel subunit alpha-2/delta-4) [Cleaved into: Voltage-dependent calcium channel subunit alpha-2-4; Voltage-dependent calcium channel subunit delta-4] antibody
Target Names
Uniprot No.

Target Background

Function
The alpha-2/delta subunit of voltage-dependent calcium channels plays a crucial role in regulating calcium current density and the activation and inactivation kinetics of the calcium channel.
Gene References Into Functions
  1. Our research has confirmed that a 36,445 bp deletion in the TRPM1 gene is a founder mutation in the Ashkenazi-Jewish (AJ) population, with a carrier rate of 1 in 50. We have also confirmed that a 35,741 bp deletion in the CACNA2D4 gene is a founder mutation in the AJ population with a carrier rate of 1 in 56. PMID: 28726569
  2. This report describes a distinctive electroretinogram (ERG) phenotype, primarily affecting the cone pathways, in two unrelated patients from different ethnic backgrounds. Both patients exhibited homozygous mutations in the CACNA2D4 gene and normal retinal imaging. PMID: 26560832
  3. A rare, partial deletion of 35.7 kb in the CACNA2D4 gene was identified in two unrelated late-onset bipolar I patients and in one control individual. PMID: 22488967
  4. The calcium channel alpha(2)delta-4 subunit exhibits limited distribution in specific cell types of the pituitary, adrenal gland, colon, and fetal liver. PMID: 12181424
Database Links

HGNC: 20202

OMIM: 608171

KEGG: hsa:93589

STRING: 9606.ENSP00000372169

UniGene: Hs.13768

Involvement In Disease
Retinal cone dystrophy 4 (RCD4)
Protein Families
Calcium channel subunit alpha-2/delta family
Subcellular Location
Membrane; Single-pass type I membrane protein.
Tissue Specificity
Predominantly expressed in certain types of endocrine cells. Present in the Paneth cells of the small intestine. Also present in the erythroblasts in the fetal liver, in the cells of the zona reticularis of the adrenal gland and in the basophils of the pi

Q&A

What is CACNA2D4 and what is its functional significance?

CACNA2D4 (Calcium Channel, Voltage-Dependent, alpha 2/delta Subunit 4) is an auxiliary subunit of voltage-gated calcium channels. Voltage-gated Ca2+ (CaV) channels are ubiquitously expressed proteins that function as Ca2+ conducting pores in the plasma membrane . These channels are heteromultimeric complexes composed of a pore-forming α1 subunit, which controls Ca2+ flow across the membrane, and several auxiliary subunits including α2δ, γ, and β . The α2δ subunit, of which CACNA2D4 is a subtype, is a heavily glycosylated protein encoded by a single gene and post-translationally cleaved to yield α2 and δ subunits connected by a disulfide bond . This structure includes a single transmembrane segment that anchors the protein complex.

The functional significance of the α2δ4 subunit extends to regulating various aspects of calcium channel activity. A notable example of its importance comes from studies of a C57BL/10 mouse substrain with a mutation in the Cacna2d4 gene, which exhibits outer retinal disease characterized by electroretinogram abnormalities including reduced b-wave and absence of photopic ERG . These mice also display morphological changes such as loss of ribbon synapses in rod photoreceptor spherules and altered cone photoreceptor pedicle structure . This indicates the critical role of α2δ4 in maintaining proper retinal function and structure.

Where is CACNA2D4 expressed in the nervous system?

The expression of CACNA2D4 has been well-characterized in retinal tissues, with some documentation in the brain as well. In the retina, α2δ4 subunit mRNA and protein are present in both mouse and rat species . Immunohistochemical studies have revealed that α2δ4 immunostaining is predominantly localized to Müller cell processes and endfeet, photoreceptor terminals, and photoreceptor outer segments . The subunit is also expressed in a subset of displaced ganglion cells and bipolar cell dendrites in the retina.

Interestingly, there are species-specific differences in the distribution pattern of CACNA2D4. In rat retina, a diffuse band of immunoreactivity is found in the outer plexiform layer (OPL), whereas in mouse retina, prominent immunoreactive puncta are observed at the base of photoreceptor terminals . This suggests potential functional differences in calcium channel organization between species.

What are the common applications for CACNA2D4 antibodies?

CACNA2D4 antibodies serve as valuable tools in multiple research applications aimed at understanding calcium channel composition, distribution, and function. The primary applications include Western blotting (WB), immunohistochemistry (IHC), immunofluorescence (IF), flow cytometry (FACS), and enzyme-linked immunosorbent assay (ELISA) .

In Western blot analysis, anti-CACNA2D4 antibodies have successfully detected the protein in various tissues including rat dorsal root ganglia (DRG), PC12 pheochromocytoma cells, and retinal homogenates . The typical apparent molecular mass of the α2δ4 subunit under non-reducing conditions is approximately 170 kDa .

For immunohistochemistry and immunofluorescence applications, these antibodies have been instrumental in localizing CACNA2D4 expression in tissue sections, particularly in retinal preparations. Researchers have employed them to detect the protein in Müller cells, photoreceptor terminals, and other retinal cell types . Additionally, they have proven useful for cell surface detection of CACNA2D4 in intact living cells, such as rat brain glioma (C6) cells .

Flow cytometry applications, though less commonly reported in the literature, can provide valuable information about CACNA2D4 expression at the single-cell level, potentially allowing for quantification of expression levels across different cell populations .

How should researchers validate CACNA2D4 antibody specificity?

Validating antibody specificity is crucial for ensuring reliable research outcomes when working with CACNA2D4 antibodies. Several complementary approaches are recommended based on established practices in the field.

The preabsorption test represents a gold standard for antibody validation. This involves pre-incubating the primary antibody with its corresponding antigen before application to tissue sections or protein samples. For example, the α2δ4 subunit antibody can be diluted in 0.1 M phosphate buffer containing 0.3% Triton X-100 and mixed with the corresponding Protein Epitope Signature Tag (PrEST) antigen of human Cacna2d4 at a final concentration of 1 μg/ml for 1–12 hours at room temperature . Absence of immunostaining in sections incubated with the preabsorbed antibody confirms specificity. This approach has been successfully employed to validate anti-CACNA2D4 antibodies in mouse and rat retinal sections .

Western blot analysis offers another critical validation method. Detection of a protein band of the expected molecular weight (approximately 170 kDa for the α2δ4 subunit under non-reducing conditions) provides evidence for antibody specificity . Comparison of band patterns across different tissues with known expression levels of CACNA2D4 can further support specificity claims.

Genetic controls, when available, provide perhaps the most definitive validation. Using tissues from Cacna2d4 knockout animals or cells with CRISPR-mediated deletion of the gene can definitively establish specificity. The absence of staining in these negative control samples strongly supports antibody specificity.

What are the optimal protocols for immunohistochemical detection of CACNA2D4?

Optimized immunohistochemical protocols for CACNA2D4 detection require careful consideration of tissue preparation, fixation, antibody dilution, and detection methods. For retinal tissues, where CACNA2D4 expression has been well-characterized, the following protocol has proven effective.

For tissue preparation, both fresh-frozen sections and fixed tissues have been successfully used. When using paraformaldehyde-fixed tissues, optimal fixation times vary by tissue thickness but generally range from 15-30 minutes for retinal sections to minimize epitope masking while maintaining tissue morphology . For antigen retrieval, which may be necessary with fixed tissues, heat-induced epitope retrieval in citrate buffer (pH 6.0) for 15-20 minutes has shown good results.

Regarding antibody dilution and incubation conditions, anti-CACNA2D4 antibodies have been effectively used at dilutions ranging from 1:100 to 1:500 depending on the specific antibody and application . For the Sigma HPA031952 antibody against human α2δ4 peptide, a dilution range of 1:100-1:500 has been reported for immunohistochemistry applications . Primary antibody incubation is typically performed overnight at 4°C to maximize specific binding while minimizing background.

For signal detection, both chromogenic and fluorescent methods have been employed successfully. In fluorescent detection, using secondary antibodies conjugated to bright, photostable fluorophores such as Alexa Fluor dyes provides optimal results. For example, goat anti-rabbit-AlexaFluor-594 secondary antibody has been used to visualize CACNA2D4 binding in cell surface detection experiments .

What are the critical considerations for Western blot analysis of CACNA2D4?

Western blot analysis of CACNA2D4 requires specific technical considerations due to the protein's high molecular weight and post-translational modifications. The following methodology addresses these challenges and optimizes detection.

Sample preparation is critical for CACNA2D4 detection. Tissues or cells should be lysed in buffers containing appropriate protease inhibitors to prevent degradation of this large protein. For membrane proteins like CACNA2D4, lysis buffers containing non-ionic detergents such as Triton X-100 or NP-40 at 0.5-1% concentration are recommended to solubilize the membrane fraction effectively.

Gel selection and running conditions must accommodate the high molecular weight of CACNA2D4 (approximately 170 kDa under non-reducing conditions). Low percentage (6-8%) polyacrylamide gels or gradient gels (4-15%) are recommended to allow proper separation of high molecular weight proteins. Extended running times at lower voltages (e.g., 80-100V) improve resolution of large proteins.

For protein transfer, wet transfer methods are preferable for large proteins like CACNA2D4. Transfer should be conducted at low voltage (30V) overnight at 4°C, or at 100V for 2 hours with cooling, to ensure efficient transfer of high molecular weight proteins without overheating.

Anti-CACNA2D4 antibodies have been successfully used at dilutions of approximately 1:200 for Western blot applications . Published studies have successfully detected CACNA2D4 in various tissues including rat DRG and rat PC12 pheochromocytoma cell lysates using this dilution .

How does CACNA2D4 localization vary across different neural tissues?

The localization pattern of CACNA2D4 exhibits notable tissue-specific and cell type-specific distribution across neural tissues, with the most detailed characterization available for retinal structures. Understanding these patterns is essential for experimental design and interpretation of results in CACNA2D4 research.

In the retina, CACNA2D4 shows a complex distribution pattern with both glial and neuronal expression. Immunohistochemical studies have demonstrated prominent localization in Müller cell processes and endfeet, suggesting a potential role in glial calcium signaling or neuron-glia interactions . The protein is also strongly expressed in photoreceptor terminals and outer segments, consistent with its proposed role in visual signal transmission . Additionally, CACNA2D4 immunoreactivity has been detected in a subset of displaced ganglion cells and bipolar cell dendrites, indicating potential roles across multiple retinal cell types .

Interestingly, species-dependent differences in CACNA2D4 localization have been observed even within retinal tissues. In rat retina, a diffuse band of immunoreactivity appears in the outer plexiform layer (OPL), whereas mouse retina displays more defined punctate immunoreactive structures at photoreceptor terminal bases . These differences may reflect species-specific adaptations in visual processing circuits.

Beyond the retina, CACNA2D4 expression has been detected in various brain regions, though detailed localization studies are more limited. The protein has been successfully detected in brain homogenates from both mouse and rat , suggesting widespread expression throughout the central nervous system.

What phenotypes are associated with CACNA2D4 mutations or deficiencies?

CACNA2D4 mutations or deficiencies produce distinctive phenotypes that provide insight into the functional significance of this calcium channel subunit. These phenotypes have been most thoroughly characterized in the visual system, where they manifest as specific structural and functional abnormalities.

In a substrain of C57BL/10 mice with a mutation in the Cacna2d4 gene, a novel outer retinal disease has been observed . Electrophysiological abnormalities include significant reduction of the b-wave component of the electroretinogram (ERG) and complete absence of the photopic ERG, which reflects cone-mediated vision . These findings indicate impaired signal transmission from photoreceptors to second-order neurons and particularly severe disruption of cone pathways.

Morphological changes in these mutant mice include loss of ribbon synapses in rod photoreceptor spherules and altered structure of cone photoreceptor pedicles . Ribbon synapses are specialized structures crucial for sustained neurotransmitter release at photoreceptor terminals, suggesting that CACNA2D4 plays an important role in the formation or maintenance of these specialized synaptic structures.

The direct mechanistic link between CACNA2D4 deficiency and these phenotypes remains an area of active investigation. Current evidence suggests two potential, non-mutually exclusive possibilities: (1) the α2δ4 subunit directly influences calcium channel function at photoreceptor terminals, affecting neurotransmitter release; or (2) the subunit participates in cellular processes required for proper formation and function of ribbon synapses .

What experimental approaches can be used to study CACNA2D4 interactions with other calcium channel subunits?

Investigating CACNA2D4 interactions with other calcium channel subunits requires sophisticated experimental approaches that can detect and characterize protein-protein interactions in native contexts. Several complementary techniques have proven valuable for this purpose.

Co-immunoprecipitation (Co-IP) represents a fundamental approach for studying protein-protein interactions. Using antibodies against CACNA2D4, researchers can precipitate the protein complex from tissue or cell lysates and then probe for the presence of other calcium channel subunits (α1, β, or γ) using specific antibodies against these proteins. This technique has been successfully applied to study interactions between different calcium channel subunits, though specific CACNA2D4 Co-IP protocols may require optimization based on the antibodies used and tissue source.

Proximity ligation assay (PLA) offers an alternative approach with the advantage of detecting protein interactions in situ within tissue sections or cultured cells. This technique uses pairs of antibodies against the proteins of interest (e.g., CACNA2D4 and various α1 subunits) followed by secondary antibodies conjugated to complementary oligonucleotides. When the proteins are in close proximity (<40 nm), the oligonucleotides can be ligated and amplified, producing a fluorescent signal that can be detected by microscopy.

Electrophysiological approaches provide functional evidence for subunit interactions. By expressing CACNA2D4 along with different α1 subunits in heterologous expression systems (such as HEK293 cells or Xenopus oocytes), researchers can measure the effects of CACNA2D4 on channel properties including activation/inactivation kinetics, voltage dependence, and current density. Changes in these parameters in the presence of CACNA2D4 provide evidence for functional interactions.

How do different commercial CACNA2D4 antibodies compare in terms of epitope specificity?

Commercial CACNA2D4 antibodies target different epitopes within the protein, which can significantly impact their performance in various applications and their ability to detect specific isoforms or post-translationally modified forms of the protein. Understanding these differences is crucial for selecting the appropriate antibody for specific research questions.

Based on the available search results, several commercial antibodies targeting different regions of CACNA2D4 have been characterized. The antibody from Alomone Labs (ACC-104) recognizes an extracellular epitope corresponding to amino acid residues 881-896 of mouse CaVα2δ4 (sequence: SERPQEMGRLLGEADG) . This antibody has been successfully used for Western blot analysis, immunohistochemical staining of frozen sections, and cell surface detection in intact living cells .

In contrast, the antibody available from Sigma (HPA031952) targets a different epitope corresponding to human residues 324-401 of the CACNA2D4 protein (sequence: NDFINIIAYNDYVHYIEPCFKGILVQADRDRREHFKLLVEELMVKGVGVVDQALREAFQILKQFQEAKQGSLCNQAIM) . This antibody has been validated for immunohistochemical applications in retinal tissue sections .

Another commercial antibody (ABIN651895) targets the N-terminal region of human CACNA2D4, specifically amino acids 89-118 . This antibody has been recommended for Western blotting and flow cytometry applications .

The table below summarizes the key features of these different CACNA2D4 antibodies:

Antibody IDTarget EpitopeHost SpeciesApplicationsReactivity
ACC-104AA 881-896 (mouse, extracellular)RabbitWB, IHC, Cell surfaceNot recommended for human samples
HPA031952AA 324-401 (human)RabbitIHCHuman
ABIN651895AA 89-118 (human, N-Term)RabbitWB, FACSHuman

What controls should be included when conducting CACNA2D4 antibody-based experiments?

Proper experimental controls are essential for ensuring the validity and reproducibility of results obtained with CACNA2D4 antibodies. A comprehensive control strategy should include both positive and negative controls that address antibody specificity and experimental reliability.

Peptide competition (preabsorption) controls represent a crucial negative control for validating antibody specificity. This involves pre-incubating the primary antibody with the immunizing peptide or recombinant protein prior to application in the experiment. For example, when using the Anti-CACNA2D4 (CaVα2δ4) (extracellular) Antibody, preincubation with CACNA2D4/Cavα2δ4 (extracellular) Blocking Peptide has been shown to eliminate specific staining in Western blot applications using rat DRG and PC12 cell lysates . Similar preabsorption approaches have been used with the Sigma CACNA2D4 antibody, where preincubation with the PrEST antigen of human Cacna2d4 at 1 μg/ml eliminated immunostaining in tissue sections .

Known positive control tissues or cells with confirmed CACNA2D4 expression should be included in every experimental run. Based on the search results, rat DRG, rat PC12 pheochromocytoma cells, and mouse and rat retinal tissues all express detectable levels of CACNA2D4 and can serve as appropriate positive controls . Specifically, rat brain glioma (C6) cells have been successfully used for cell surface detection of CACNA2D4 .

For double-labeling immunohistochemistry experiments, proper controls for antibody cross-reactivity are essential. These include omitting one primary antibody while applying both secondary antibodies to ensure no cross-detection occurs. When studying CACNA2D4 localization in the retina, researchers have successfully combined anti-CACNA2D4 antibodies with antibodies against specific markers such as Bassoon and CtBP2 (both markers for presynaptic active zones) .

What are the emerging techniques for studying CACNA2D4 function in calcium signaling?

Emerging technologies are expanding our ability to investigate CACNA2D4 function in calcium signaling with unprecedented precision and physiological relevance. These advanced approaches promise to provide deeper insights into the molecular mechanisms and functional significance of this calcium channel subunit.

Genetically encoded calcium indicators (GECIs) combined with CACNA2D4 manipulation represent a powerful approach for studying how this subunit influences calcium dynamics in living cells. By expressing GECIs such as GCaMP variants in cell types expressing CACNA2D4 (e.g., photoreceptors, Müller cells) while simultaneously modulating CACNA2D4 expression or function, researchers can directly visualize how this subunit affects calcium influx patterns. This approach is particularly valuable for understanding CACNA2D4's role in specialized contexts like photoreceptor terminals, where calcium signaling is crucial for neurotransmitter release.

CRISPR-Cas9 genome editing technologies offer precise tools for manipulating CACNA2D4 expression or introducing specific mutations to study structure-function relationships. This approach allows researchers to generate cell lines or animal models with targeted modifications to CACNA2D4, potentially recapitulating human disease mutations or creating domain-specific alterations to dissect the functional contributions of different protein regions. Combined with electrophysiological recordings or calcium imaging, these genetic tools provide a powerful system for mechanistic studies.

Super-resolution microscopy techniques such as STORM, PALM, and STED microscopy enable visualization of CACNA2D4 localization with nanometer-scale precision. These approaches can reveal the precise spatial organization of CACNA2D4 relative to other calcium channel subunits and synaptic components, particularly valuable for understanding its arrangement at specialized structures like photoreceptor ribbon synapses. Combined with appropriate antibodies or fluorescent protein tagging, these techniques can provide unprecedented insights into the nanoscale architecture of calcium channel complexes containing CACNA2D4.

How does CACNA2D4 research inform potential therapeutic approaches for retinal disorders?

Research on CACNA2D4 has significant implications for developing therapeutic strategies for retinal disorders, particularly those involving synaptic transmission defects or calcium signaling dysregulation. Understanding these connections can guide future translational research efforts.

The established role of CACNA2D4 in retinal function, particularly at photoreceptor terminals, suggests that modulating its activity could potentially address certain visual disorders. The observation that Cacna2d4 mutations in mice lead to reduced b-wave amplitude and absence of photopic ERG indicates that conditions with similar electrophysiological signatures might involve CACNA2D4 dysfunction. Therapeutic approaches targeting CACNA2D4 or compensating for its loss could potentially restore aspects of visual function in such cases.

Gene therapy approaches represent a promising avenue for CACNA2D4-related disorders. For recessive conditions caused by loss-of-function mutations, viral vector-mediated delivery of functional CACNA2D4 to affected retinal cell types could potentially restore normal protein expression and function. The established tropism of certain adeno-associated virus (AAV) serotypes for specific retinal cell types makes this approach particularly feasible for targeting photoreceptors or Müller cells expressing CACNA2D4.

Small molecule modulators of calcium channel function offer another potential therapeutic approach. While direct CACNA2D4 modulators have not been extensively characterized, the α2δ subunit family is the target of gabapentinoid drugs in other contexts. Understanding whether similar compounds could modulate CACNA2D4-containing channels, and whether such modulation would have therapeutic benefits for specific retinal conditions, represents an important area for future investigation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.