ccdc89 Antibody

What is CCDC89 and what cellular functions is it associated with?

CCDC89 (Coiled-Coil Domain Containing 89) is a protein also known as BOIP (Bc8 orange-interacting protein) or FLJ38159 . The protein contains coiled-coil domains which typically facilitate protein-protein interactions in cellular systems. While the specific cellular functions of CCDC89 are still being elucidated, coiled-coil domain-containing proteins generally play crucial roles in cellular architecture, molecular trafficking, and signaling pathways. Research protocols examining CCDC89 function typically employ antibody-based detection methods to characterize its expression patterns across various tissues and cell types.

What applications are CCDC89 antibodies validated for?

CCDC89 antibodies have been validated for multiple experimental applications in molecular and cellular biology research. These include Western Blot (recommended concentration: 0.4 μg/ml), Immunohistochemistry (IHC), Immunocytochemistry/Immunofluorescence (ICC/IF) (recommended concentration: 1-4 μg/ml), and ELISA . Validation data indicates that these antibodies provide reliable detection across these applications when used at optimized concentrations. Researchers should consider that different applications may require specific antibody preparations, such as unconjugated antibodies for Western blotting versus fluorophore-conjugated antibodies for immunofluorescence studies.

What species reactivity can be expected from commercial CCDC89 antibodies?

Commercial CCDC89 antibodies demonstrate varied species reactivity depending on the specific product and epitope targeted. The primary reactivity is against human CCDC89, with several antibodies also showing cross-reactivity with mouse samples . Some specialized antibodies have been developed with reactivity against zebrafish (Danio rerio) CCDC89 . When designing experiments with model organisms, researchers should carefully evaluate the documented cross-reactivity of their selected antibody, as sequence homology varies across species and may affect binding affinity and specificity.

How should CCDC89 antibodies be stored and handled for optimal performance?

For optimal antibody performance and longevity, CCDC89 antibodies should be stored according to manufacturer specifications. Typically, short-term storage at 4°C is appropriate for antibodies in active use . For long-term storage, aliquoting the antibody and maintaining it at -20°C is recommended . This practice minimizes protein degradation from repeated freeze-thaw cycles, which can significantly impact antibody binding efficiency and experimental reproducibility. Most commercial CCDC89 antibodies are formulated in PBS (pH 7.2) containing 40% glycerol with 0.02% sodium azide as a preservative . When handling these preparations, researchers should use sterile technique and avoid contamination that could compromise antibody integrity.

What are the typical immunogens used for CCDC89 antibody production?

CCDC89 antibodies are typically generated using recombinant protein fragments as immunogens. These fragments correspond to specific amino acid sequences of the human CCDC89 protein. For example, one commercially available antibody was developed against a recombinant protein corresponding to this amino acid sequence: "PEERLEKQNEKLNNQEEETEFKELDGLREALANLRGLSEEERSEKAMLRSRIEEQSQLICILKRRSDEALERCQILELLNAELEEKMMQE" . Another antibody utilized recombinant Human CCDC89 protein spanning amino acids 1-200 . Different immunogens target distinct regions of the protein, which may affect the antibody's performance in specific applications and its ability to recognize different protein conformations or isoforms.

What strategies can enhance specificity validation for CCDC89 antibodies?

Rigorous validation of CCDC89 antibody specificity is essential for generating reliable research data. Beyond manufacturer validation, which often includes protein array screening against the target protein plus hundreds of non-specific proteins , researchers should implement additional controls. A comprehensive validation approach includes:

• Positive and negative control tissues/cell lines with known CCDC89 expression profiles

• Knockdown/knockout validation using siRNA or CRISPR-Cas9 to deplete CCDC89

• Peptide competition assays to confirm binding specificity

• Comparison of staining patterns using antibodies targeting different epitopes of CCDC89

• Western blot analysis to confirm detection of bands at the expected molecular weight

These multiple lines of evidence provide stronger confidence in antibody specificity than relying on a single validation method, especially important for proteins like CCDC89 where functional characterization is still evolving.

How do different epitope regions of CCDC89 antibodies affect experimental outcomes?

The epitope specificity of CCDC89 antibodies significantly influences experimental results across different applications. Commercial antibodies target various regions of the protein, including amino acids 1-200, 114-145, 265-293, and 288-374 . These different targeting strategies affect:

• Protein conformation detection: Antibodies targeting different domains may vary in their ability to recognize native versus denatured protein conformations.

• Post-translational modification (PTM) sensitivity: Epitopes containing PTM sites may show differential recognition depending on the modification status.

• Isoform specificity: Alternative splicing variants may be recognized differently by antibodies targeting distinct regions.

• Application compatibility: Some epitopes perform better in fixed versus live cell applications or in Western blotting versus immunoprecipitation.

Researchers investigating specific functional domains of CCDC89 should select antibodies targeting relevant epitopes and validate their performance in the specific experimental context. For comprehensive studies, utilizing multiple antibodies targeting different epitopes can provide complementary data.

What are the critical parameters for optimizing Western blot protocols with CCDC89 antibodies?

Optimizing Western blot protocols for CCDC89 detection requires careful attention to several experimental parameters:

• Sample preparation: Optimal lysis buffers and protease inhibitors should be selected based on subcellular localization of CCDC89.

• Protein loading: Typically 20-50 μg of total protein per lane provides adequate detection.

• Antibody concentration: The recommended starting concentration is 0.4 μg/ml for Western blot applications , with titration as needed.

• Incubation conditions: Primary antibody incubation at 4°C overnight often yields better signal-to-noise ratio than shorter incubations at room temperature.

• Detection system: Enhanced chemiluminescence (ECL) systems provide sufficient sensitivity for most applications, though fluorescence-based systems may offer better quantitative linearity.

• Stripping and reprobing: If multiple proteins need to be detected on the same membrane, mild stripping conditions should be optimized to preserve CCDC89 epitopes.

A systematic approach to optimizing these parameters will help ensure reproducible and quantifiable Western blot results when working with CCDC89 antibodies.

What approaches can resolve inconsistent staining patterns in immunohistochemistry with CCDC89 antibodies?

Inconsistent immunohistochemical staining with CCDC89 antibodies may result from multiple factors. Researchers can implement these troubleshooting strategies:

• Antigen retrieval optimization: Systematically test heat-induced epitope retrieval methods (citrate buffer pH 6.0 vs. EDTA buffer pH 9.0) and enzymatic retrieval approaches.

• Fixation assessment: Compare results between differently fixed samples (formalin, paraformaldehyde, alcohol-based fixatives) as fixation chemistry can impact epitope accessibility.

• Blocking optimization: Test different blocking agents (BSA, normal serum, commercial blockers) to reduce background while preserving specific staining.

• Antibody concentration gradient: Perform a titration series (typically 1-4 μg/ml for immunohistochemistry applications) to determine optimal signal-to-noise ratio.

• Detection system comparison: Compare avidin-biotin complex (ABC) methods with polymer-based detection systems for sensitivity and specificity.

• Counterstain adjustment: Modify hematoxylin intensity to ensure it doesn't mask subtle CCDC89 staining patterns.

Maintaining detailed records of these optimization steps aids in establishing reproducible protocols across different tissue types and experimental conditions.

How can CCDC89 antibodies be effectively utilized in multiplex immunofluorescence studies?

Multiplex immunofluorescence incorporating CCDC89 antibodies requires careful planning and optimization:

• Antibody compatibility assessment: CCDC89 antibodies are available with various conjugates including unconjugated, FITC, biotin, AbBy Fluor® 555, AbBy Fluor® 680, and AbBy Fluor® 594 . Selection should be based on desired detection channels and other markers in the panel.

• Sequential staining optimization: If targeting multiple antigens, determine whether simultaneous or sequential staining produces better results with CCDC89 antibodies.

• Cross-reactivity evaluation: Test each antibody individually before combining them to identify potential cross-reactivity issues.

• Signal amplification: For low-abundance CCDC89 expression, consider tyramide signal amplification or similar approaches to enhance detection sensitivity.

• Spectral unmixing: For complex multiplex panels, implement spectral unmixing algorithms to separate overlapping fluorescence signals.

This methodical approach enables researchers to effectively integrate CCDC89 detection into complex immunofluorescence studies, providing valuable insights into its co-localization with other proteins of interest.

What control samples are essential when designing experiments with CCDC89 antibodies?

Robust experimental design with CCDC89 antibodies requires appropriate controls to ensure valid interpretation of results:

• Positive tissue/cell controls: Include samples with confirmed CCDC89 expression based on previous literature or preliminary data.

• Negative tissue/cell controls: Incorporate samples with minimal or no CCDC89 expression to assess background staining.

• Isotype controls: Use non-specific IgG from the same host species as the CCDC89 antibody (typically rabbit IgG) to evaluate non-specific binding.

• Secondary-only controls: Omit primary antibody to assess background from secondary detection reagents.

• Absorption controls: Pre-incubate the antibody with immunizing peptide to confirm staining specificity.

• Genetic manipulation controls: When possible, include CCDC89 knockdown/knockout samples as definitive specificity controls.

These controls collectively provide a framework for accurate data interpretation and troubleshooting of unexpected results when working with CCDC89 antibodies.

How should researchers approach antibody selection for studying potential CCDC89 protein interactions?

When investigating CCDC89 protein interactions, antibody selection requires careful consideration:

• Epitope location assessment: Select antibodies targeting epitopes away from predicted protein interaction domains to avoid interference with complex formation.

• Application validation: Ensure the antibody is validated specifically for immunoprecipitation or proximity ligation assays if these are planned methods.

• Native conformation recognition: Choose antibodies demonstrated to recognize native protein conformations rather than just denatured epitopes.

• Cross-reactivity profile: Evaluate potential cross-reactivity with structurally similar proteins, especially other coiled-coil domain-containing proteins.

• Buffer compatibility: Confirm compatibility with buffers that preserve protein-protein interactions (typically less stringent than Western blot lysis buffers).

These considerations help researchers select appropriate antibodies for studying the protein interaction network of CCDC89, an important aspect of understanding its biological function.

What methodological approaches can improve quantitative analysis of CCDC89 expression?

Accurate quantification of CCDC89 expression requires methodological rigor:

• Standard curve implementation: For quantitative Western blots or ELISAs, include a standard curve using recombinant CCDC89 protein.

• Loading control optimization: Select appropriate loading controls based on experimental conditions (β-actin, GAPDH, or total protein staining).

• Digital image analysis: Employ software that can accurately segment cellular compartments to quantify CCDC89 localization in immunofluorescence studies.

• Technical replication: Perform multiple technical replicates to assess method reproducibility and calculate coefficient of variation.

• Normalization strategy: Establish consistent normalization approaches, particularly important when comparing CCDC89 expression across different tissues or treatment conditions.

These approaches significantly enhance the reliability of quantitative measurements of CCDC89 expression across diverse experimental systems.

How can researchers address potential cross-reactivity issues with CCDC89 antibodies?

Cross-reactivity remains a significant challenge when working with antibodies against less-characterized proteins like CCDC89. Effective strategies to address this include:

• Bioinformatic analysis: Conduct sequence homology searches to identify proteins with similar epitopes to those targeted by the CCDC89 antibody.

• Orthogonal validation: Confirm findings using multiple antibodies targeting different CCDC89 epitopes (e.g., comparing results from antibodies targeting AA 1-200 versus AA 288-374) .

• Mass spectrometry verification: Perform immunoprecipitation followed by mass spectrometry to identify all proteins captured by the antibody.

• Peptide array screening: Test antibody specificity against peptide arrays containing potential cross-reactive epitopes.

• Secondary validation: Confirm antibody-based findings with non-antibody methods such as RNA expression analysis or fluorescent protein tagging.

This multi-faceted approach helps distinguish true CCDC89 signals from potential artifacts arising from antibody cross-reactivity.

What strategies can overcome detection challenges in tissues with low CCDC89 expression?

Detecting low-abundance CCDC89 expression requires specialized approaches:

• Signal amplification systems: Implement tyramide signal amplification or similar technologies to enhance detection sensitivity.

• Sample enrichment: Consider subcellular fractionation to concentrate compartments where CCDC89 is predominantly localized.

• Extended antibody incubation: Increase primary antibody incubation time (e.g., 48-72 hours at 4°C) with careful optimization of antibody concentration.

• Alternative fixation: Test alternative fixation protocols that may better preserve CCDC89 epitopes.

• Super-resolution microscopy: Employ techniques like STORM or STED microscopy to detect sparse CCDC89 molecules below the diffraction limit.

• Proximity ligation assay: Use proximity ligation assays to amplify detection of low-abundance protein interactions involving CCDC89.

These technical approaches can significantly improve detection of CCDC89 in tissues or cells with naturally low expression levels or in conditions where expression is downregulated.

How do different antibody clonality options affect CCDC89 detection outcomes?

The choice between monoclonal and polyclonal CCDC89 antibodies significantly impacts experimental outcomes:

Most commercially available CCDC89 antibodies are polyclonal and raised in rabbits . While polyclonal antibodies often provide stronger signals by recognizing multiple epitopes, researchers requiring absolute specificity for a particular CCDC89 domain might benefit from monoclonal antibodies when available or consider custom antibody development for specific research needs.

How can CCDC89 antibodies be utilized in emerging single-cell analysis techniques?

Integrating CCDC89 antibodies into single-cell analysis platforms represents an emerging frontier:

• Mass cytometry (CyTOF): CCDC89 antibodies can be metal-conjugated for inclusion in CyTOF panels, enabling simultaneous detection with dozens of other protein markers at single-cell resolution.

• Single-cell Western blotting: Microfluidic platforms supporting single-cell protein analysis can incorporate CCDC89 antibodies to assess expression heterogeneity across individual cells.

• Imaging mass cytometry: Metal-labeled CCDC89 antibodies can provide spatial information about protein expression in tissue sections with subcellular resolution.

• CODEX multiplexed imaging: CCDC89 antibodies can be barcoded for inclusion in highly multiplexed imaging approaches that preserve spatial context.

• Antibody-based single-cell sorting: CCDC89 antibodies can be utilized to isolate specific cell populations for downstream molecular analysis.

These approaches allow researchers to move beyond population-averaged measurements to understand cell-to-cell variability in CCDC89 expression and its relationship to cellular phenotypes.

What considerations apply when selecting CCDC89 antibodies for studies across different model organisms?

Cross-species applications of CCDC89 antibodies require careful evaluation:

• Sequence homology analysis: Compare the amino acid sequence of the antibody's target epitope across species of interest to predict potential cross-reactivity.

• Species-specific validation: Even when manufacturers claim cross-reactivity (e.g., with mouse or zebrafish CCDC89) , independent validation in the specific model organism is essential.

• Application-specific testing: An antibody that cross-reacts in Western blot may not work in immunohistochemistry applications due to differences in epitope accessibility.

• Fixation optimization: Different model organisms may require distinct fixation protocols to preserve CCDC89 epitopes.

• Control tissue selection: Identify appropriate positive and negative control tissues specific to each model organism.

This systematic approach ensures reliable CCDC89 detection across different model systems, enabling comparative studies of protein function across evolutionary boundaries.

How can researchers effectively incorporate CCDC89 antibodies in high-throughput screening approaches?

Adaptation of CCDC89 antibodies for high-throughput applications requires specific optimization:

• Automation compatibility: Evaluate antibody performance under automated liquid handling conditions, which may differ from manual protocols.

• Miniaturization: Test antibody performance in reduced volumes and on miniaturized platforms such as microwell arrays or microfluidic devices.

• Reproducibility assessment: Perform extensive reproducibility testing across plates and batches to ensure consistent results.

• Detection system selection: Choose detection methods that balance sensitivity, dynamic range, and throughput requirements.

• Multiplexing capability: Assess compatibility with simultaneous detection of other proteins of interest in multiplexed assay formats.