Eotaxin 2 Human

Eotaxin-2 Human Recombinant (CCL24)
Shipped with Ice Packs
In Stock

Description

Structure and Genetics

Eotaxin-2 is a 78-amino acid protein with a molecular mass of ~8.8 kDa, encoded by the CCL24 gene located on chromosome 7 . It shares structural homology with other eotaxins but diverges significantly in its NH₂-terminal region, showing only 39% identity with eotaxin-1 (CCL11) . Truncated variants (73, 75, or 76 residues) have been identified, though their biological relevance remains unclear .

FeatureEotaxin-2 (CCL24)Eotaxin-1 (CCL11)
Gene LocationChromosome 7 Chromosome 17
ReceptorCCR3 CCR3
Primary Target CellsEosinophils, basophils Eosinophils
Th2 Cytokine SensitivitySuppressed by IL-4 in monocytes Upregulated by IL-4/IL-13

Chemotaxis and Activation

Eotaxin-2 induces chemotaxis of eosinophils, basophils, and resting T lymphocytes via CCR3 . It exhibits bimodal concentration-dependent effects, with maximal eosinophil migration observed at 100 nM . Key findings include:

  • Cross-desensitization with eotaxin-1 and MCP-4, confirming shared receptor usage (CCR3) .

  • Histamine and leukotriene C4 release from IL-3-primed basophils .

  • In vivo recruitment of eosinophils and basophils in rhesus monkeys, mimicking allergic inflammation .

Cell TypeResponse to Eotaxin-2Receptor Involvement
EosinophilsChemotaxis, Ca²⁺ mobilizationCCR3
BasophilsHistamine/leukotriene releaseCCR3
NeutrophilsMinimal/no responseNone
T LymphocytesChemotaxis (resting cells)CCR3

Hematopoietic Suppression

Eotaxin-2 inhibits colony formation by high proliferative potential colony-forming cells, suggesting a role in myeloid progenitor regulation .

Cellular Sources

  • Monocytes: Constitutive production, upregulated by IL-1β, LPS, and zymosan .

  • Macrophages: IL-4 upregulates production, while LPS has no effect .

  • Dermal Fibroblasts: No production under basal or stimulated conditions .

StimulusEffect on MonocytesEffect on Macrophages
IL-1β↑↑↑ (3-fold increase) Not reported
LPS↑↑↑ (3-fold increase) No change
IL-4↓↓ (Suppression) ↑↑ (Upregulation)

Th2 vs. Innate Immunity

  • Monocyte-derived eotaxin-2: Linked to innate immunity (e.g., microbial responses) .

  • Macrophage-derived eotaxin-2: Associated with adaptive immunity (Th2-biased responses) .

Asthma and Allergic Diseases

Elevated eotaxin-2 levels correlate with eosinophilic inflammation in asthma, reflecting its role in allergic pathophysiology . Intradermal injection in humans induces:

  • Early-phase wheal and flare (mast cell degranulation) .

  • Late-phase eosinophil infiltration (24–48 hours post-injection) .

Atherosclerosis and Vascular Inflammation

Eotaxin-2 enhances TLR4 expression in endothelial cells, increasing sensitivity to LPS and promoting monocytic adhesion—a mechanism implicated in atherosclerosis progression .

Cancer Metastasis

High eotaxin-2 concentrations may promote tumor metastasis, though specific pathways remain under investigation .

Key Studies

  1. Constitutive Monocyte Production: Peripheral blood monocytes generate eotaxin-2 without stimulation, contributing to baseline plasma levels .

  2. Th2 Cytokine Suppression: IL-4 inhibits eotaxin-2 production in monocytes but enhances it in macrophages, highlighting context-dependent regulation .

  3. Human Skin Responses: Intradermal eotaxin-2 induces neutrophil infiltration (unlike eotaxin-1), suggesting distinct roles in inflammatory cascades .

Mechanistic Insights

  • CCR3 Dependency: Antibody blockade or desensitization abrogates eotaxin-2 effects on eosinophils and basophils .

  • Receptor Selectivity: No activity on neutrophils, monocytes, or lymphocytes lacking CCR3 .

Product Specs

Introduction
Eotaxin-2, also known as MPIF2 and Ckb6, is a CC chemokine primarily produced by activated monocytes and T lymphocytes. It exhibits selective chemoattraction towards cells expressing the CCR3 receptor, encompassing eosinophils, basophils, Th2 T cells, mast cells, and specific dendritic cell subsets. Moreover, Eotaxin-2 demonstrates an inhibitory effect on the proliferation of multipotential hematopoietic progenitor cells. The mature protein, often subject to C-terminal truncation, comprises 78 amino acids in its human form and 92 amino acids in its murine counterpart (prior to truncation). Notably, CCL24, a related chemokine, shares functional similarities with Eotaxin-2, acting as a chemoattractant for resting T lymphocytes and eosinophils, albeit with weaker activity on neutrophils and no effect on monocytes or activated lymphocytes. Similar to Eotaxin-2, CCL24 exhibits suppressive effects on colony formation in a multipotential hematopoietic progenitor cell line, binding to the CCR3 receptor.
Description
Recombinant human CCL24, produced in E. coli, is a single, non-glycosylated polypeptide chain composed of 78 amino acids, resulting in a molecular weight of 8.8 kDa. The purification process employs proprietary chromatographic techniques to ensure high purity.
Physical Appearance
Sterile white lyophilized powder.
Formulation
The lyophilized CCL24 protein is prepared in a sterile solution containing 20mM PBS (pH 7.4) and 0.15M sodium chloride at a concentration of 1 mg/mL.
Solubility
To reconstitute the lyophilized CCL24, it is recommended to dissolve it in sterile 18 MΩ-cm H2O at a minimum concentration of 100 µg/mL. Further dilutions can be made using other aqueous solutions.
Stability
Lyophilized Eotaxin-2 exhibits stability at room temperature for up to 3 weeks; however, for long-term storage, it is recommended to store it in a desiccated state below -18°C. After reconstitution, CCL24 remains stable at 4°C for 2-7 days. For extended storage periods, freezing below -18°C is advisable, and the addition of a carrier protein like HSA or BSA (0.1%) is recommended. Avoid repeated freeze-thaw cycles.
Purity
The purity of CCL24 exceeds 97.0%, as determined by reverse-phase high-performance liquid chromatography (RP-HPLC) and sodium dodecyl-sulfate polyacrylamide gel electrophoresis (SDS-PAGE).
Biological Activity
The biological activity of CCL24 is evaluated based on its chemotactic effect on human peripheral blood eosinophils (PBE). A concentration range of 50-100 ng/mL induces chemotaxis, corresponding to a specific activity of 10,000-20,000 IU/mg.
Synonyms
C-C motif chemokine 24, Small-inducible cytokine A24, Myeloid progenitor inhibitory factor 2, CK-beta-6, Eosinophil chemotactic protein 2, Eotaxin-2, CCL24, Ckb-6, MPIF2, MPIF-2, SCYA24, Eotaxin2, CCL-24.
Source
Escherichia Coli.
Amino Acid Sequence
VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKGGVIFTTKKGQQFCG
DPKQEWV QRYMKNLDAKQKKASPRARAVA.

Q&A

Eotaxin-2 (Human) Research FAQs

Advanced Research Questions

How do genetic polymorphisms in eotaxin-2 influence its plasma levels and disease associations?

A single nucleotide polymorphism (SNP) in the eotaxin-2 promoter (rs11575042) is associated with elevated plasma levels in asthma patients . Haplotype analysis reveals linkage disequilibrium with other SNPs (e.g., rs2284628), impacting transcriptional activity.

Experimental Approach:

  • Genotype cohorts using TaqMan assays.

  • Measure plasma eotaxin-2 via ELISA.

  • Correlate SNPs with clinical phenotypes (e.g., eosinophil counts).

Data Conflict: Some studies report no association in non-asthmatic populations, highlighting context-dependent regulation .

What experimental models demonstrate eotaxin-2’s therapeutic potential in autoimmune diseases?

In experimental autoimmune encephalomyelitis (EAE), anti-eotaxin-2 monoclonal antibodies (e.g., D8) reduce disease severity:

  • Dosage: 25–100 μg/day intravenously post-immunization .

  • Outcomes: Lower clinical scores, reduced CNS inflammation, and decreased anti-MOG antibodies .

ParameterControl (PBS)Anti-Eotaxin-2 (100 μg)
Mean clinical score3.2 ± 0.41.8 ± 0.3
CNS inflammationSevereMild

Mechanistic Insight: Blocking eotaxin-2 disrupts CCR3+ cell migration into inflamed tissues .

How do IL-4 and STAT-6 signaling pathways regulate eotaxin-2 expression?

IL-4 induces eotaxin-2 mRNA in a STAT-6-dependent manner:

  • Transgenic IL-4 mice: Lung-specific IL-4 overexpression increases eotaxin-2 mRNA 5-fold .

  • STAT-6 knockout: Abolishes IL-4-driven eotaxin-2 upregulation .

Experimental Validation:

  • Use STAT-6−/− mice in allergen challenge models.

  • Apply intranasal IL-4/anti-IL-4 complexes to bypass systemic effects.

Product Science Overview

Discovery and Cloning

CCL24 was initially cloned from a library of activated macrophages. It was shown that CCL24 binds to the receptor of eotaxin-1 (CCL11) and MCP-4 (CCL13). Additionally, CCL24 shares the CCR3 receptor with CCL26, CCL5, and CCL7 .

Structure and Expression

The human CCL24 protein consists of 93 amino acids with a predicted molecular mass of approximately 10.4 kDa. When expressed in E. coli, the DTT-reduced protein migrates at approximately 12 kDa and the non-reduced protein migrates at 14 kDa by SDS-PAGE . CCL24 is constitutively expressed in the jejunum and spleen and can be induced in the lung by allergen challenge and IL-4 .

Function and Bioactivity

CCL24 is known for its chemotactic properties, particularly for eosinophils, basophils, Th2 T cells, mast cells, and certain subsets of dendritic cells . It has lower chemotactic activity for neutrophils and none for monocytes and activated lymphocytes . CCL24 is a strong suppressor of colony formation by multipotential hematopoietic progenitor cell lines .

Role in Disease

The eotaxin/CCR3 axis, which includes CCL24, has been extensively studied in the pathogenesis of asthma and allergy. It has also been associated with additional inflammatory and autoimmune disorders, including inflammatory bowel disease, multiple sclerosis, eosinophilic esophagitis, and rheumatoid arthritis . Furthermore, CCL24 has been linked to neovascular age-related macular degeneration .

Recombinant Production

Recombinant human CCL24 is produced in various expression systems, including E. coli and HEK293 cells. The recombinant protein is often purified to high levels of purity (>95%) and is used in research to study its biological functions and potential therapeutic applications .

Storage and Handling

Recombinant CCL24 can be stored at -20°C for up to six months or at -70°C or colder until the expiration date. For maximum results, it is recommended to quick spin the vial prior to opening and avoid repeated freeze/thaw cycles .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.