CDK3 antibodies are immunoglobulins specifically designed to recognize and bind to the cyclin-dependent kinase 3 protein, a serine/threonine kinase that plays critical roles in cell cycle regulation, particularly in the G0-G1 and G1-S transitions. These antibodies have become indispensable research tools for studying CDK3 expression, localization, and function in both normal and pathological conditions. The development and characterization of CDK3-specific antibodies have enabled researchers to uncover the complex roles of this kinase in cellular processes and disease states, particularly in cancer development and progression .
CDK3 antibodies are available in various formats, including polyclonal and monoclonal antibodies raised in different host species, each offering distinct advantages for specific applications. These antibodies have undergone extensive validation to ensure specificity and sensitivity in detecting CDK3 protein across various experimental techniques, making them valuable tools for both basic research and clinical investigations .
Before delving into the specifics of CDK3 antibodies, it is important to understand the biological significance of their target. CDK3 belongs to the larger family of cyclin-dependent kinases, which includes CDK2, CDK4, and CDK6, all essential for various phases of cell cycle regulation. The CDK3 protein specifically interacts with CCNC/cyclin-C during interphase and phosphorylates multiple substrates, including histone H1, ATF1, RB1, and CABLES1. Through these interactions, CDK3 influences critical cellular processes such as cell proliferation, differentiation, and transformation .
A diverse range of CDK3 antibodies is currently available from various commercial sources, each with distinct characteristics suitable for specific research applications. These antibodies differ in terms of host species, clonality, epitope recognition, and validated applications.
The generation of CDK3 antibodies typically involves immunizing host animals with specific CDK3 immunogens. For instance, the Abcam antibody (ab96847) was generated using a recombinant fragment protein within Human CDK3 amino acids 1-250 . Similarly, the Sigma-Aldrich antibody (HPA007420) was raised against a specific immunogen sequence: "PSEDTWPGVTQLPDYKGSFPKWTRKGLEEIVPNLEPEGRDLLMQLLQYDPSQRITAKTALAHPYFSSPEPSPAARQYVLQRFRH" .
These antibodies undergo rigorous validation processes to ensure specificity and sensitivity. Validation methods include Western blotting with recombinant proteins or cell lysates, immunohistochemistry on tissue samples, and immunofluorescence studies on cultured cells. For example, the Abcam CDK3 antibody was validated using Western blotting on HepG2 whole cell lysate .
CDK3 antibodies have been employed in a wide range of experimental techniques, allowing researchers to investigate CDK3 expression, localization, and function in various biological contexts.
Western blotting represents one of the most common applications for CDK3 antibodies, enabling the detection of CDK3 protein in cell and tissue lysates. This technique allows researchers to assess CDK3 expression levels and correlate them with specific biological conditions or disease states. Most commercially available CDK3 antibodies have been validated for Western blotting applications, with recommended dilutions typically ranging from 1:1000 to 1:2000 .
Immunohistochemistry (IHC) and immunofluorescence (IF) techniques utilizing CDK3 antibodies provide valuable insights into the spatial distribution of CDK3 in tissues and cells. These approaches are particularly useful for investigating CDK3 localization in normal versus pathological samples, such as comparing CDK3 expression in normal brain tissue with glioblastoma tissue .
For immunohistochemistry applications, CDK3 antibodies are typically used at dilutions ranging from 1:50 to 1:200, as recommended for the Sigma-Aldrich antibody (HPA007420) . For immunofluorescence studies, the same antibody is recommended at concentrations of 0.25-2 μg/mL .
Some CDK3 antibodies, such as the Santa Cruz 4B6 monoclonal antibody, have been validated for enzyme-linked immunosorbent assay (ELISA) applications . This technique allows for quantitative assessment of CDK3 protein levels in biological samples. Additionally, certain antibodies like those from Proteintech Group have been validated for flow cytometry, enabling the analysis of CDK3 expression at the single-cell level .
Understanding the structure and function of CDK3 is crucial for appreciating the value of CDK3 antibodies in research and potential therapeutic applications.
CDK3 plays crucial roles in cell cycle regulation, particularly in the transitions from G0 to G1 and from G1 to S phase. During these transitions, CDK3 forms complexes with specific cyclins, such as cyclin C and cyclin E, to phosphorylate target substrates .
One of the key functions of CDK3 is the phosphorylation of retinoblastoma protein (RB1) at serine residues 807/811, which is required for the G0-G1 transition . CDK3 also phosphorylates ATF1 at serine 63, enhancing its transactivation and transcriptional activities, which promotes cell proliferation and transformation .
Additionally, CDK3 contributes to the G1-S transition by activating E2F1, E2F2, and E2F3 transcription factors in an RB1-independent manner . These functions highlight the importance of CDK3 in regulating cell proliferation and division.
The role of CDK3 in cell cycle regulation has been extensively studied using CDK3 antibodies, revealing its critical functions in coordinating cell division.
CDK3 partners with specific cyclins to form active complexes that regulate cell cycle progression. It has been demonstrated that CDK3 forms complexes with cyclin C during interphase , and with cyclin E to regulate the G1-S phase transition . These interactions are essential for CDK3's kinase activity and its ability to phosphorylate target substrates.
The CDK3/cyclin C complex plays a crucial role in the G0-G1 transition by phosphorylating RB1 at specific serine residues (807/811) . This phosphorylation event is necessary for cells to exit the quiescent G0 state and enter the G1 phase of the cell cycle.
Furthermore, CDK3 contributes to the G1-S transition, where DNA replication occurs. This transition is vital for proper cell division and growth, and dysregulation of CDK3 can lead to uncontrolled cell proliferation, a hallmark of cancer . The CDK3/cyclin E complex is involved in this transition, similar to the better-characterized CDK2/cyclin E complex .
Research utilizing CDK3 antibodies has revealed significant insights into the involvement of CDK3 in cancer development and progression, particularly in glioblastoma and breast cancer.
Studies have demonstrated that CDK3 is highly expressed in human glioblastoma tissue compared to normal brain tissue . This elevated expression suggests a potential role for CDK3 in the development or progression of this aggressive brain tumor.
Research has shown that CDK3 phosphorylates ATF1 at serine 63, enhancing its transactivation and transcriptional activities, which promotes cell proliferation and transformation in glioblastoma cells . Furthermore, small interfering RNA (siRNA) directed against CDK3 has been shown to suppress ATF1 activity, resulting in inhibition of cell proliferation and growth of human glioblastoma T98G cells in soft agar assays .
These findings suggest that CDK3 may serve as a potential therapeutic target for glioblastoma treatment, and CDK3 antibodies have been instrumental in elucidating these mechanisms.
In breast cancer, CDK3 has been identified as a target of microRNA-4469 (miR-4469), suggesting a complex regulatory mechanism controlling CDK3 expression . Research has shown that while altering the expression of miR-4469 did not change CDK3 mRNA levels, overexpression of miR-4469 resulted in a decrease of CDK3 protein level through translational inhibition .
Interestingly, up-regulation of miR-4469 promoted MCF7 breast cancer cell motility, while overexpression of CDK3 could abolish this increased motility . Conversely, silencing of miR-4469 resulted in a reduction of MCF7 cell motility . These findings demonstrate that CDK3 is directly targeted by miR-4469 and plays a role in regulating breast cancer cell motility.
The genetic locus of CDK3 has been mapped to chromosome 17q22-qter region, where it was found to be involved in a chromosomal rearrangement in a breast cancer cell line, possibly resulting in altered expression . This genetic evidence further supports the potential involvement of CDK3 in breast cancer development.
The involvement of CDK3 in cell cycle regulation and its dysregulation in various cancers make it an attractive target for therapeutic intervention. CDK3 antibodies have been crucial in validating CDK3 as a potential target and in screening for compounds that modulate its activity.
Research has shown that inhibition of CDK3 expression or activity can suppress cancer cell proliferation and transformation. For instance, siRNA-mediated knockdown of CDK3 inhibited the growth of glioblastoma cells and suppressed Ras G12V/CDK3/ATF1-induced foci formation in NIH3T3 cells .
These findings suggest that small molecule inhibitors targeting CDK3 kinase activity or disrupting its interactions with cyclins or substrates could potentially serve as anticancer agents. While specific CDK3 inhibitors are still under development, the current understanding of CDK3 structure and function, largely facilitated by CDK3 antibodies, provides a foundation for such therapeutic approaches.
CDK3 antibodies also hold potential for diagnostic and prognostic applications in cancer. Given the elevated expression of CDK3 in certain cancers, such as glioblastoma , immunohistochemical detection of CDK3 using specific antibodies could serve as a biomarker for disease diagnosis or prognosis.
Furthermore, monitoring CDK3 expression or activity in patient samples using CDK3 antibodies might help predict treatment response or disease progression, although more clinical studies are needed to validate these potential applications.
CDK3 is a serine/threonine-protein kinase that plays a critical role in the control of the eukaryotic cell cycle. It is specifically involved in G0-G1 and G1-S cell cycle transitions. CDK3 interacts with CCNC/cyclin-C during interphase and phosphorylates several important substrates including histone H1, ATF1, RB1, and CABLES1 .
The phosphorylation of ATF1 at serine 63 by CDK3 enhances ATF1's transactivation and transcriptional activities, which promotes cell proliferation and transformation. Additionally, CDK3/cyclin-C mediated RB1 phosphorylation is required for G0-G1 transition. CDK3 also promotes G1-S transition likely by contributing to the activation of E2F1, E2F2, and E2F3 in an RB1-independent manner .
To distinguish CDK3 from other CDK family members, researchers should:
Select antibodies raised against unique epitopes - Several commercial antibodies are generated against specific regions of CDK3 that have minimal homology with other CDKs. For example, antibodies targeting the N-terminal region (aa 1-250) or specific peptide sequences unique to CDK3 .
Perform careful validation experiments:
Conduct comparative analysis with other CDK antibodies to ensure specificity.
Consider protein interaction studies, as CDK3 has specific binding partners like cyclin-C that can help distinguish it from other CDKs .
Based on the validation data from multiple sources, CDK3 antibodies have been successfully applied in:
Most published research has employed Western blotting as the primary method for studying CDK3 expression and phosphorylation states .
The CDK3-ATF1 signaling axis plays a crucial role in cellular transformation and cancer development through several mechanisms:
Phosphorylation of ATF1: CDK3 specifically phosphorylates ATF1 at serine 63 in its kinase-inducible domain (KID), which enhances ATF1's transactivation activity by promoting recruitment of the coactivator CREB-binding protein (CBP)/p300 .
Enhanced cell proliferation: Research has shown that CDK3-mediated ATF1 phosphorylation promotes cell proliferation. siRNA directed against CDK3 (si-CDK3) suppresses ATF1 activity, resulting in inhibition of proliferation and growth of human glioblastoma T98G cells in soft agar .
Transformation properties: CDK3 enhances epidermal growth factor (EGF)-induced anchorage-independent cell transformation in JB6 Cl41 cells. Additionally, si-CDK3 suppresses Ras^G12V/cdk3/ATF1-induced foci formation in NIH3T3 cells .
Cancer relevance: CDK3 protein expression levels are higher in human cancer cell lines and human glioblastoma tissue compared with normal brain tissue, suggesting its role in cancer development .
Oncogenic signaling: Experimental evidence has demonstrated that the CDK3-ATF1 signaling axis cooperates with oncogenic Ras to promote cellular transformation, indicating its involvement in multiple oncogenic pathways .
The experimental evidence for this signaling axis was confirmed through foci forming assays, where NIH3T3 cells were transiently transfected with various combinations of H-Ras^G12V, CDK3, ATF1, ATF1 S63A (phosphorylation-deficient mutant), or si-CDK3 .
Designing effective siRNA against CDK3 for knockdown experiments requires careful consideration of several factors:
Target sequence selection: Based on published research, effective siRNA against CDK3 has been designed targeting specific regions. The mutations of CDK3 (408T/C, 411G/A, 412T/C, and 414G/C) have been used to generate siRNA-resistant CDK3 expression vectors for rescue experiments .
Vector system: The pU6pro vector has been successfully used to construct si-RNA against CDK3 (si-CDK3). This approach involves:
Validation controls:
Experimental verification:
For optimal results, researchers should target multiple regions of the CDK3 mRNA and validate knockdown efficiency with proper controls.
Research has demonstrated significant differences in CDK3 expression between normal and cancer tissues:
Expression patterns: CDK3 protein expression levels are higher in human cancer cell lines and human glioblastoma tissue compared with normal brain tissue .
Methodological approaches to demonstrate differences:
a. Western blot analysis:
Compare CDK3 protein levels in cancer cell lines (e.g., T98G, HepG2, MCF-7, Jurkat) versus normal tissues
Use validated antibodies at optimized dilutions (1:1000-1:4000)
b. Immunohistochemistry (IHC):
Compare normal versus tumor tissue sections
Use optimized antibody dilutions (1:100-1:400)
Apply appropriate antigen retrieval (TE buffer pH 9.0 or citrate buffer pH 6.0)
c. Functional validation:
Validated specimens: The most well-documented differences have been observed in:
These approaches collectively provide strong evidence for the differential expression of CDK3 in cancer versus normal tissues.
For optimal detection of CDK3 via Western blotting, researchers should follow these recommendations based on published protocols:
Sample preparation:
Gel electrophoresis:
Antibody selection and dilution:
Detection:
Controls:
Example protocol from validated studies:
10% SDS-PAGE
Transfer to PVDF membrane
Block with 5% non-fat milk
Incubate with anti-CDK3 antibody (1:1000 dilution) overnight at 4°C
Wash with TBST buffer
Incubate with HRP-conjugated secondary antibody
Proximity ligation assay (PLA) is a powerful technique for studying CDK3 interactions with binding partners at the endogenous level. Based on published research, here's how to implement this approach:
Principle and advantages:
Methodology for CDK3 interactions:
Cell preparation: Culture cells on coverslips and fix with appropriate fixative
Primary antibodies: Use anti-CDK3 antibody and antibody against potential interacting protein (e.g., PTP1B, cyclins) raised in different species
PLA probes: Incubate with species-specific secondary antibodies conjugated to oligonucleotides
Ligation and amplification: Add DNA ligase and polymerase to form and amplify circular DNA
Detection: Hybridize with fluorescent complementary oligonucleotides and visualize under fluorescence microscope
Validated applications for CDK3:
Controls and validation:
This approach has successfully demonstrated the interaction between endogenous PTP1B and CDK3 in multiple glioblastoma cell lines, revealing interaction sites in both cytoplasmic and nuclear compartments .
Validating the specificity of CDK3 antibodies is crucial for reliable research outcomes. Based on established practices in the field, here's a comprehensive approach:
Western blot analysis:
Knockdown/knockout validation:
Peptide competition assays:
Cross-reactivity assessment:
Immunoprecipitation followed by mass spectrometry:
Multi-antibody concordance:
These validation steps ensure that the observed signals are truly representative of CDK3 protein and not due to cross-reactivity with other proteins.
Several experimental approaches have been validated to assess CDK3's role in cellular transformation:
Soft agar colony formation assay:
Foci formation assay:
NIH3T3 cells can be transfected with various combinations of:
H-Ras^G12V (100 ng)
CDK3 (500 ng)
ATF1 (500 ng)
ATF1 S63A (500 ng, phosphorylation-deficient mutant)
si-CDK3 (500 ng)
After 2 weeks of culture in 5% calf serum/DMEM, foci are fixed with methanol, stained with 0.5% crystal violet, and counted
This approach has shown that si-CDK3 suppresses Ras^G12V/CDK3/ATF1-induced foci formation
EGF-induced transformation assay:
Molecular signaling analysis:
In vivo tumorigenesis assays:
These complementary approaches provide robust validation of CDK3's role in cellular transformation across multiple experimental systems.
Accurately assessing CDK3 kinase activity requires specific methodological approaches:
In vitro kinase assays:
Immunoprecipitation: Isolate CDK3 using specific antibodies from cell lysates
Substrate selection: Use known CDK3 substrates (ATF1, histone H1, RB1, CABLES1)
Reaction conditions: Incubate with substrates in the presence of [γ-32P]ATP or non-radioactive ATP
Detection: Analyze by autoradiography or phospho-specific antibodies
Controls: Include kinase-dead CDK3 mutants as negative controls
Phospho-specific antibody detection:
Cellular reporter systems:
ATF1 transcriptional activity: Use reporter constructs with ATF1 binding sites
Phosphorylation-dependent interactions: Monitor CDK3-dependent protein interactions
Cell cycle progression: Assess G0-G1 and G1-S transitions as functional readouts of CDK3 activity
Cyclin binding and activation:
Inhibitor studies:
Chemical inhibitors: Assess effects of CDK inhibitors on CDK3 activity
Specificity controls: Include related CDKs to establish selectivity
Dose-response relationships: Determine IC50 values for inhibition
These approaches, particularly when used in combination, provide robust assessment of CDK3 kinase activity in experimental systems.
Researchers working with CDK3 antibodies may encounter several challenges:
Weak or nonspecific signals in Western blotting:
Cross-reactivity with other CDK family members:
Variable expression levels across cell lines:
Challenges in detecting phosphorylated substrates:
Inconsistent IHC/IF staining:
Difficulties in co-immunoprecipitation experiments:
By implementing these solutions, researchers can significantly improve the reliability and reproducibility of their CDK3 antibody experiments.
When investigating CDK3 function and expression, the following controls are essential for rigorous and reproducible research:
Antibody specificity controls:
Expression manipulation controls:
Functional/activity controls:
Experimental technique controls:
Biological response controls:
Including these comprehensive controls significantly enhances the reliability and interpretability of experiments investigating CDK3 function and expression.
Several emerging research areas could benefit from improved CDK3 antibody methodologies:
Single-cell analysis of CDK3 expression and activity:
CDK3 as a therapeutic target in cancer:
PTP1B-CDK3 signaling axis in cancer progression:
CDK3 in cell cycle regulation beyond G0-G1 and G1-S transitions:
Development of CDK3 biomarkers for cancer prognosis:
These emerging areas will require continued refinement of antibody technologies, including:
Higher specificity antibodies distinguishing CDK3 from other CDK family members
Improved phospho-specific antibodies for key substrates
Compatible protocols for clinical samples and advanced imaging techniques
Advancing these methodologies will accelerate our understanding of CDK3's roles in normal physiology and disease pathogenesis.
Recent advances in rapid antibody discovery technologies offer significant potential to improve CDK3-focused research:
Microfluidics-enabled antibody discovery:
Recent technology has demonstrated rapid discovery of monoclonal antibodies by screening millions of mouse and human antibody-secreting cells (ASCs)
This approach has yielded antibodies with extraordinarily high affinity (<1 pM) and functionality in just 2 weeks
Applied to CDK3 research, this could generate highly specific antibodies targeting unique epitopes or post-translational modifications
Benefits for CDK3 research:
Higher specificity: Improved distinction between CDK3 and other CDK family members
Post-translational modification detection: Better antibodies against specific phosphorylation states
Expanded application range: Antibodies optimized for multiple techniques (WB, IHC, IF, IP)
Increased sensitivity: Detection of lower abundance CDK3 in primary tissues
Potential applications:
Integration with other technologies:
The high hit rates (>85% binding) and rapid development timeline (2 weeks) offered by these new technologies could significantly accelerate CDK3 research by providing more precise tools for investigating its diverse cellular functions and potential as a therapeutic target .
By facilitating access to the underexplored antibody-secreting cell compartment, these approaches enable more efficient antibody discovery and could drive new immunological studies into CDK3's roles in cell cycle regulation and cancer progression .