CDK3 Antibody

Shipped with Ice Packs
In Stock

Description

Introduction to CDK3 Antibody

CDK3 antibodies are immunoglobulins specifically designed to recognize and bind to the cyclin-dependent kinase 3 protein, a serine/threonine kinase that plays critical roles in cell cycle regulation, particularly in the G0-G1 and G1-S transitions. These antibodies have become indispensable research tools for studying CDK3 expression, localization, and function in both normal and pathological conditions. The development and characterization of CDK3-specific antibodies have enabled researchers to uncover the complex roles of this kinase in cellular processes and disease states, particularly in cancer development and progression .

CDK3 antibodies are available in various formats, including polyclonal and monoclonal antibodies raised in different host species, each offering distinct advantages for specific applications. These antibodies have undergone extensive validation to ensure specificity and sensitivity in detecting CDK3 protein across various experimental techniques, making them valuable tools for both basic research and clinical investigations .

Significance of CDK3 in Cellular Processes

Before delving into the specifics of CDK3 antibodies, it is important to understand the biological significance of their target. CDK3 belongs to the larger family of cyclin-dependent kinases, which includes CDK2, CDK4, and CDK6, all essential for various phases of cell cycle regulation. The CDK3 protein specifically interacts with CCNC/cyclin-C during interphase and phosphorylates multiple substrates, including histone H1, ATF1, RB1, and CABLES1. Through these interactions, CDK3 influences critical cellular processes such as cell proliferation, differentiation, and transformation .

Types and Sources of CDK3 Antibodies

A diverse range of CDK3 antibodies is currently available from various commercial sources, each with distinct characteristics suitable for specific research applications. These antibodies differ in terms of host species, clonality, epitope recognition, and validated applications.

Antibody Generation and Characterization

The generation of CDK3 antibodies typically involves immunizing host animals with specific CDK3 immunogens. For instance, the Abcam antibody (ab96847) was generated using a recombinant fragment protein within Human CDK3 amino acids 1-250 . Similarly, the Sigma-Aldrich antibody (HPA007420) was raised against a specific immunogen sequence: "PSEDTWPGVTQLPDYKGSFPKWTRKGLEEIVPNLEPEGRDLLMQLLQYDPSQRITAKTALAHPYFSSPEPSPAARQYVLQRFRH" .

These antibodies undergo rigorous validation processes to ensure specificity and sensitivity. Validation methods include Western blotting with recombinant proteins or cell lysates, immunohistochemistry on tissue samples, and immunofluorescence studies on cultured cells. For example, the Abcam CDK3 antibody was validated using Western blotting on HepG2 whole cell lysate .

Applications and Techniques

CDK3 antibodies have been employed in a wide range of experimental techniques, allowing researchers to investigate CDK3 expression, localization, and function in various biological contexts.

Western Blotting

Western blotting represents one of the most common applications for CDK3 antibodies, enabling the detection of CDK3 protein in cell and tissue lysates. This technique allows researchers to assess CDK3 expression levels and correlate them with specific biological conditions or disease states. Most commercially available CDK3 antibodies have been validated for Western blotting applications, with recommended dilutions typically ranging from 1:1000 to 1:2000 .

Immunohistochemistry and Immunofluorescence

Immunohistochemistry (IHC) and immunofluorescence (IF) techniques utilizing CDK3 antibodies provide valuable insights into the spatial distribution of CDK3 in tissues and cells. These approaches are particularly useful for investigating CDK3 localization in normal versus pathological samples, such as comparing CDK3 expression in normal brain tissue with glioblastoma tissue .

For immunohistochemistry applications, CDK3 antibodies are typically used at dilutions ranging from 1:50 to 1:200, as recommended for the Sigma-Aldrich antibody (HPA007420) . For immunofluorescence studies, the same antibody is recommended at concentrations of 0.25-2 μg/mL .

ELISA and Flow Cytometry

Some CDK3 antibodies, such as the Santa Cruz 4B6 monoclonal antibody, have been validated for enzyme-linked immunosorbent assay (ELISA) applications . This technique allows for quantitative assessment of CDK3 protein levels in biological samples. Additionally, certain antibodies like those from Proteintech Group have been validated for flow cytometry, enabling the analysis of CDK3 expression at the single-cell level .

CDK3 Protein Structure and Function

Understanding the structure and function of CDK3 is crucial for appreciating the value of CDK3 antibodies in research and potential therapeutic applications.

Biological Functions

CDK3 plays crucial roles in cell cycle regulation, particularly in the transitions from G0 to G1 and from G1 to S phase. During these transitions, CDK3 forms complexes with specific cyclins, such as cyclin C and cyclin E, to phosphorylate target substrates .

One of the key functions of CDK3 is the phosphorylation of retinoblastoma protein (RB1) at serine residues 807/811, which is required for the G0-G1 transition . CDK3 also phosphorylates ATF1 at serine 63, enhancing its transactivation and transcriptional activities, which promotes cell proliferation and transformation .

Additionally, CDK3 contributes to the G1-S transition by activating E2F1, E2F2, and E2F3 transcription factors in an RB1-independent manner . These functions highlight the importance of CDK3 in regulating cell proliferation and division.

CDK3 in Cell Cycle Regulation

The role of CDK3 in cell cycle regulation has been extensively studied using CDK3 antibodies, revealing its critical functions in coordinating cell division.

Interaction with Cyclins

CDK3 partners with specific cyclins to form active complexes that regulate cell cycle progression. It has been demonstrated that CDK3 forms complexes with cyclin C during interphase , and with cyclin E to regulate the G1-S phase transition . These interactions are essential for CDK3's kinase activity and its ability to phosphorylate target substrates.

Regulation of G0-G1 and G1-S Transitions

The CDK3/cyclin C complex plays a crucial role in the G0-G1 transition by phosphorylating RB1 at specific serine residues (807/811) . This phosphorylation event is necessary for cells to exit the quiescent G0 state and enter the G1 phase of the cell cycle.

Furthermore, CDK3 contributes to the G1-S transition, where DNA replication occurs. This transition is vital for proper cell division and growth, and dysregulation of CDK3 can lead to uncontrolled cell proliferation, a hallmark of cancer . The CDK3/cyclin E complex is involved in this transition, similar to the better-characterized CDK2/cyclin E complex .

Role of CDK3 in Cancer Development

Research utilizing CDK3 antibodies has revealed significant insights into the involvement of CDK3 in cancer development and progression, particularly in glioblastoma and breast cancer.

CDK3 in Glioblastoma

Studies have demonstrated that CDK3 is highly expressed in human glioblastoma tissue compared to normal brain tissue . This elevated expression suggests a potential role for CDK3 in the development or progression of this aggressive brain tumor.

Research has shown that CDK3 phosphorylates ATF1 at serine 63, enhancing its transactivation and transcriptional activities, which promotes cell proliferation and transformation in glioblastoma cells . Furthermore, small interfering RNA (siRNA) directed against CDK3 has been shown to suppress ATF1 activity, resulting in inhibition of cell proliferation and growth of human glioblastoma T98G cells in soft agar assays .

These findings suggest that CDK3 may serve as a potential therapeutic target for glioblastoma treatment, and CDK3 antibodies have been instrumental in elucidating these mechanisms.

CDK3 in Breast Cancer

In breast cancer, CDK3 has been identified as a target of microRNA-4469 (miR-4469), suggesting a complex regulatory mechanism controlling CDK3 expression . Research has shown that while altering the expression of miR-4469 did not change CDK3 mRNA levels, overexpression of miR-4469 resulted in a decrease of CDK3 protein level through translational inhibition .

Interestingly, up-regulation of miR-4469 promoted MCF7 breast cancer cell motility, while overexpression of CDK3 could abolish this increased motility . Conversely, silencing of miR-4469 resulted in a reduction of MCF7 cell motility . These findings demonstrate that CDK3 is directly targeted by miR-4469 and plays a role in regulating breast cancer cell motility.

The genetic locus of CDK3 has been mapped to chromosome 17q22-qter region, where it was found to be involved in a chromosomal rearrangement in a breast cancer cell line, possibly resulting in altered expression . This genetic evidence further supports the potential involvement of CDK3 in breast cancer development.

CDK3 as a Therapeutic Target

The involvement of CDK3 in cell cycle regulation and its dysregulation in various cancers make it an attractive target for therapeutic intervention. CDK3 antibodies have been crucial in validating CDK3 as a potential target and in screening for compounds that modulate its activity.

Targeting CDK3 in Cancer Therapy

Research has shown that inhibition of CDK3 expression or activity can suppress cancer cell proliferation and transformation. For instance, siRNA-mediated knockdown of CDK3 inhibited the growth of glioblastoma cells and suppressed Ras G12V/CDK3/ATF1-induced foci formation in NIH3T3 cells .

These findings suggest that small molecule inhibitors targeting CDK3 kinase activity or disrupting its interactions with cyclins or substrates could potentially serve as anticancer agents. While specific CDK3 inhibitors are still under development, the current understanding of CDK3 structure and function, largely facilitated by CDK3 antibodies, provides a foundation for such therapeutic approaches.

Diagnostic and Prognostic Applications

CDK3 antibodies also hold potential for diagnostic and prognostic applications in cancer. Given the elevated expression of CDK3 in certain cancers, such as glioblastoma , immunohistochemical detection of CDK3 using specific antibodies could serve as a biomarker for disease diagnosis or prognosis.

Furthermore, monitoring CDK3 expression or activity in patient samples using CDK3 antibodies might help predict treatment response or disease progression, although more clinical studies are needed to validate these potential applications.

Product Specs

Buffer
0.1M NaHCO3, 0.1M Glycine, 0.02% Sodium Azide, 50% Glycerol, pH 7.3. Store at -20°C. Avoid freeze/thaw cycles.
Lead Time
Typically, we can ship your orders within 1-3 business days after receiving them. Delivery times may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timeframes.
Synonyms
Cdk 3 antibody; Cdk3 antibody; CDK3_HUMAN antibody; CDKN3 antibody; Cell division kinase 3 antibody; Cell division protein kinase 3 antibody; Cyclin dependent kinase 3 antibody; Cyclin-dependent kinase 3 antibody; OTTHUMP00000206828 antibody; p36 antibody
Target Names
CDK3
Uniprot No.

Target Background

Function
CDK3, a serine/threonine-protein kinase, plays a crucial role in regulating the eukaryotic cell cycle. It participates in the G0-G1 and G1-S cell cycle transitions. CDK3 interacts with CCNC (cyclin-C) during interphase. It phosphorylates various substrates, including histone H1, ATF1, RB1 (retinoblastoma protein), and CABLES1. Phosphorylation of ATF1 activates its transactivation and transcriptional activities, promoting cell proliferation and transformation. CDK3/cyclin-C mediated RB1 phosphorylation is essential for G0-G1 transition. Additionally, CDK3 promotes G1-S transition, possibly by contributing to the activation of E2F1, E2F2, and E2F3 in an RB1-independent manner.
Gene References Into Functions
  1. These findings suggest that miR-125a-3p can act as a novel tumor suppressor in ER(+) breast cancer by targeting CDK3, potentially offering a therapeutic approach for TamR breast cancer therapy. PMID: 28939591
  2. HuR facilitated lung cancer stemness dependent on CDK3 expression. miR-873 or miR-125a-3p levels exhibited a negative correlation with HuR and CDK3 expression levels in lung cancer tissues. HuR facilitates lung cancer stemness through the regulation of the miR-873/CDK3 and miR-125a-3p/CDK3 axis. PMID: 29344850
  3. Ectopic expression of HuR promotes breast cancer cell proliferation and survival by directly binding to and stabilizing CDK3 mRNA. PMID: 28501005
  4. These results provide evidence supporting the oncogenic potential of NFAT3 and suggest that CDK3-mediated phosphorylation of NFAT3 plays a significant role in skin tumorigenesis. PMID: 27893713
  5. The analysis of tumor and matched normal lung tissues indicates that miR-150 downregulation in lung tumors correlates with higher CDK3 levels. Furthermore, miR-150 transfection experiments with cancer-derived cell lines demonstrate that miR-150-mediated CDK3 suppression directly induces growth inhibition. PMID: 28108217
  6. High Cdk3-promoted epithelial-mesenchymal transition through activating AP-1 is involved in colorectal cancer metastasis. PMID: 26755651
  7. Data indicate that microRNA miR-214 possesses tumor-suppressive activity in hepatocellular carcinoma (HCC) through inhibition of E2F2 transcription factor (E2F2), cyclin-dependent kinases CDK3, and CDK6. PMID: 26498144
  8. Mir-873 inhibits ESR1 activity and cell growth by targeting CDK3. PMID: 25531331
  9. CDK3 is associated with the progression of NPC (nasopharyngeal carcinoma) and may serve as a potential biomarker for predicting the prognosis of patients with NPC. PMID: 24691537
  10. The Walleye dermal sarcoma virus cyclin functions as a structural ortholog of cyclin C despite its limited amino acid sequence identity with C cyclins or any known cyclins and activates Cdk8 and Cdk3. PMID: 21067790
  11. A non-cdk8-associated cellular pool of cyclin C combines with cdk3 to stimulate pRb phosphorylation at S807/811 during the G0/G1 transition, and this phosphorylation is required for cells to exit G0 efficiently. PMID: 15084261
  12. Expression levels of cdk3 are higher in human cancer cell lines and glioblastoma tissue compared to normal brain tissue. Cdk3 phosphorylates activating transcription factor 1 (ATF1) and enhances the transactivation and transcriptional activities of ATF1. PMID: 18794154

Show More

Hide All

Database Links

HGNC: 1772

OMIM: 123828

KEGG: hsa:1018

STRING: 9606.ENSP00000400088

UniGene: Hs.706766

Protein Families
Protein kinase superfamily, CMGC Ser/Thr protein kinase family, CDC2/CDKX subfamily
Tissue Specificity
Expressed in cancer cell lines and glioblastoma tissue.

Q&A

What is CDK3 and what are its known cellular functions?

CDK3 is a serine/threonine-protein kinase that plays a critical role in the control of the eukaryotic cell cycle. It is specifically involved in G0-G1 and G1-S cell cycle transitions. CDK3 interacts with CCNC/cyclin-C during interphase and phosphorylates several important substrates including histone H1, ATF1, RB1, and CABLES1 .

The phosphorylation of ATF1 at serine 63 by CDK3 enhances ATF1's transactivation and transcriptional activities, which promotes cell proliferation and transformation. Additionally, CDK3/cyclin-C mediated RB1 phosphorylation is required for G0-G1 transition. CDK3 also promotes G1-S transition likely by contributing to the activation of E2F1, E2F2, and E2F3 in an RB1-independent manner .

How can researchers accurately distinguish CDK3 from other CDK family members?

To distinguish CDK3 from other CDK family members, researchers should:

  • Select antibodies raised against unique epitopes - Several commercial antibodies are generated against specific regions of CDK3 that have minimal homology with other CDKs. For example, antibodies targeting the N-terminal region (aa 1-250) or specific peptide sequences unique to CDK3 .

  • Perform careful validation experiments:

    • Western blot with positive and negative controls

    • Test in cell lines with known CDK3 expression levels

    • Include appropriate molecular weight markers (CDK3 is observed at 40-45 kDa on Western blots)

    • Use siRNA knockdown of CDK3 as a specificity control

  • Conduct comparative analysis with other CDK antibodies to ensure specificity.

  • Consider protein interaction studies, as CDK3 has specific binding partners like cyclin-C that can help distinguish it from other CDKs .

What are the primary applications for CDK3 antibodies in research?

Based on the validation data from multiple sources, CDK3 antibodies have been successfully applied in:

ApplicationValidated SpeciesTypical DilutionsNotes
Western Blot (WB)Human, Mouse, Rat1:500-1:4000Most commonly validated application
Immunohistochemistry (IHC)Human1:50-1:400Used for tissue expression studies
Immunofluorescence (IF/ICC)Human1:200-1:800For subcellular localization
Flow Cytometry (FC)Human0.25 μg per 10^6 cellsFor intracellular staining
Proximity Ligation AssayHumanAntibody-specificFor protein-protein interaction studies

Most published research has employed Western blotting as the primary method for studying CDK3 expression and phosphorylation states .

How does the CDK3-ATF1 signaling axis contribute to cell transformation and cancer development?

The CDK3-ATF1 signaling axis plays a crucial role in cellular transformation and cancer development through several mechanisms:

  • Phosphorylation of ATF1: CDK3 specifically phosphorylates ATF1 at serine 63 in its kinase-inducible domain (KID), which enhances ATF1's transactivation activity by promoting recruitment of the coactivator CREB-binding protein (CBP)/p300 .

  • Enhanced cell proliferation: Research has shown that CDK3-mediated ATF1 phosphorylation promotes cell proliferation. siRNA directed against CDK3 (si-CDK3) suppresses ATF1 activity, resulting in inhibition of proliferation and growth of human glioblastoma T98G cells in soft agar .

  • Transformation properties: CDK3 enhances epidermal growth factor (EGF)-induced anchorage-independent cell transformation in JB6 Cl41 cells. Additionally, si-CDK3 suppresses Ras^G12V/cdk3/ATF1-induced foci formation in NIH3T3 cells .

  • Cancer relevance: CDK3 protein expression levels are higher in human cancer cell lines and human glioblastoma tissue compared with normal brain tissue, suggesting its role in cancer development .

  • Oncogenic signaling: Experimental evidence has demonstrated that the CDK3-ATF1 signaling axis cooperates with oncogenic Ras to promote cellular transformation, indicating its involvement in multiple oncogenic pathways .

The experimental evidence for this signaling axis was confirmed through foci forming assays, where NIH3T3 cells were transiently transfected with various combinations of H-Ras^G12V, CDK3, ATF1, ATF1 S63A (phosphorylation-deficient mutant), or si-CDK3 .

What approaches can be used to design effective siRNA against CDK3 for knockdown experiments?

Designing effective siRNA against CDK3 for knockdown experiments requires careful consideration of several factors:

  • Target sequence selection: Based on published research, effective siRNA against CDK3 has been designed targeting specific regions. The mutations of CDK3 (408T/C, 411G/A, 412T/C, and 414G/C) have been used to generate siRNA-resistant CDK3 expression vectors for rescue experiments .

  • Vector system: The pU6pro vector has been successfully used to construct si-RNA against CDK3 (si-CDK3). This approach involves:

    • Designing synthetic primers

    • Annealing the primers

    • Introducing them into the pU6pro vector digested with XbaI and BbsI

  • Validation controls:

    • Include a scrambled siRNA control (si-mock) as a negative control

    • Generate rescue constructs with silent mutations to validate specificity

    • Confirm knockdown by Western blot analysis

  • Experimental verification:

    • Confirm reduced CDK3 protein levels via Western blot

    • Assess functional consequences (e.g., reduced ATF1 phosphorylation)

    • Test biological effects (e.g., reduced cell proliferation or transformation)

For optimal results, researchers should target multiple regions of the CDK3 mRNA and validate knockdown efficiency with proper controls.

How does CDK3 expression differ between normal and cancer tissues, and what methodologies best demonstrate this difference?

Research has demonstrated significant differences in CDK3 expression between normal and cancer tissues:

  • Expression patterns: CDK3 protein expression levels are higher in human cancer cell lines and human glioblastoma tissue compared with normal brain tissue .

  • Methodological approaches to demonstrate differences:

    a. Western blot analysis:

    • Compare CDK3 protein levels in cancer cell lines (e.g., T98G, HepG2, MCF-7, Jurkat) versus normal tissues

    • Use validated antibodies at optimized dilutions (1:1000-1:4000)

    • Include proper loading controls and quantification methods

    b. Immunohistochemistry (IHC):

    • Compare normal versus tumor tissue sections

    • Use optimized antibody dilutions (1:100-1:400)

    • Apply appropriate antigen retrieval (TE buffer pH 9.0 or citrate buffer pH 6.0)

    • Quantify staining intensity and distribution

    c. Functional validation:

    • Manipulate CDK3 levels in normal versus cancer cells

    • Assess impact on cell proliferation, transformation, and other cancer-related phenotypes

    • Use soft agar assays to measure anchorage-independent growth

  • Validated specimens: The most well-documented differences have been observed in:

    • Glioblastoma versus normal brain tissue

    • Human cancer cell lines (HepG2, T98G, MCF-7, Jurkat) versus normal counterparts

These approaches collectively provide strong evidence for the differential expression of CDK3 in cancer versus normal tissues.

What are the optimal protocols for detecting CDK3 via Western blotting?

For optimal detection of CDK3 via Western blotting, researchers should follow these recommendations based on published protocols:

  • Sample preparation:

    • Prepare whole cell lysates from appropriate cells (HepG2, MCF-7, Jurkat, T98G, U87-MG, U251, HEK293T, Raw264.7, PC12)

    • Use standard lysis buffers containing protease and phosphatase inhibitors

  • Gel electrophoresis:

    • Use 10% SDS-PAGE for optimal separation

    • Load 30 μg of protein per lane

  • Antibody selection and dilution:

    • Primary antibody: Use validated anti-CDK3 antibodies at dilutions of 1:1000-1:4000

    • Secondary antibody: Use appropriate HRP-conjugated secondary antibodies

  • Detection:

    • CDK3 appears at approximately 40-45 kDa on Western blots

    • Use ECL or other appropriate detection methods

  • Controls:

    • Positive controls: HepG2, MCF-7, Jurkat cells

    • Loading controls: Standard housekeeping proteins (β-actin, GAPDH)

    • Specificity control: siRNA-mediated knockdown of CDK3

Example protocol from validated studies:

  • 10% SDS-PAGE

  • Transfer to PVDF membrane

  • Block with 5% non-fat milk

  • Incubate with anti-CDK3 antibody (1:1000 dilution) overnight at 4°C

  • Wash with TBST buffer

  • Incubate with HRP-conjugated secondary antibody

  • Develop using ECL substrate

How can proximity ligation assays be used to study CDK3 interactions with binding partners?

Proximity ligation assay (PLA) is a powerful technique for studying CDK3 interactions with binding partners at the endogenous level. Based on published research, here's how to implement this approach:

  • Principle and advantages:

    • Detects protein-protein interactions with high specificity

    • Enables visualization of interactions in situ

    • Can detect endogenous protein interactions without overexpression

    • Produces fluorescent signals only when proteins are within 40 nm of each other

  • Methodology for CDK3 interactions:

    • Cell preparation: Culture cells on coverslips and fix with appropriate fixative

    • Primary antibodies: Use anti-CDK3 antibody and antibody against potential interacting protein (e.g., PTP1B, cyclins) raised in different species

    • PLA probes: Incubate with species-specific secondary antibodies conjugated to oligonucleotides

    • Ligation and amplification: Add DNA ligase and polymerase to form and amplify circular DNA

    • Detection: Hybridize with fluorescent complementary oligonucleotides and visualize under fluorescence microscope

  • Validated applications for CDK3:

    • CDK3-PTP1B interactions have been successfully detected in glioblastoma cell lines (LN229, U87-MG, and U251)

    • Multiple interaction loci were observed in both cytoplasm and nucleus

  • Controls and validation:

    • Negative controls: Omission of one primary antibody

    • Positive controls: Known interacting partners

    • Validation: Confirm interactions by co-immunoprecipitation

This approach has successfully demonstrated the interaction between endogenous PTP1B and CDK3 in multiple glioblastoma cell lines, revealing interaction sites in both cytoplasmic and nuclear compartments .

Validating the specificity of CDK3 antibodies is crucial for reliable research outcomes. Based on established practices in the field, here's a comprehensive approach:

  • Western blot analysis:

    • Test across multiple cell lines with known CDK3 expression (HepG2, T98G, MCF-7)

    • Verify single band at expected molecular weight (40-45 kDa)

    • Compare with positive control cell lines

  • Knockdown/knockout validation:

    • Perform siRNA-mediated knockdown of CDK3

    • Compare antibody signal in control versus knockdown samples

    • Use rescue experiments with CDK3 expression constructs to confirm specificity

  • Peptide competition assays:

    • Pre-incubate antibody with immunizing peptide

    • Signal should be blocked or significantly reduced

    • Include non-competing peptide as negative control

  • Cross-reactivity assessment:

    • Test against recombinant CDK family members

    • Examine potential cross-reactivity with closely related proteins

    • Use protein arrays to test broader specificity (e.g., arrays of 364 human recombinant protein fragments)

  • Immunoprecipitation followed by mass spectrometry:

    • Perform IP with the CDK3 antibody

    • Analyze pulled-down proteins by mass spectrometry

    • Confirm presence of CDK3 and known interacting partners

  • Multi-antibody concordance:

    • Compare results using multiple antibodies targeting different epitopes of CDK3

    • Consistent results across antibodies increase confidence in specificity

These validation steps ensure that the observed signals are truly representative of CDK3 protein and not due to cross-reactivity with other proteins.

What experimental approaches can validate the role of CDK3 in cellular transformation?

Several experimental approaches have been validated to assess CDK3's role in cellular transformation:

  • Soft agar colony formation assay:

    • Researchers have demonstrated that siRNA against CDK3 suppresses growth of human glioblastoma T98G cells in soft agar

    • This assay measures anchorage-independent growth, a hallmark of transformed cells

  • Foci formation assay:

    • NIH3T3 cells can be transfected with various combinations of:

      • H-Ras^G12V (100 ng)

      • CDK3 (500 ng)

      • ATF1 (500 ng)

      • ATF1 S63A (500 ng, phosphorylation-deficient mutant)

      • si-CDK3 (500 ng)

    • After 2 weeks of culture in 5% calf serum/DMEM, foci are fixed with methanol, stained with 0.5% crystal violet, and counted

    • This approach has shown that si-CDK3 suppresses Ras^G12V/CDK3/ATF1-induced foci formation

  • EGF-induced transformation assay:

    • Using JB6 Cl41 cells, researchers have shown that CDK3 enhances EGF-induced transformation

    • This model is particularly useful for studying promotion-sensitive cellular transformation

  • Molecular signaling analysis:

    • Phosphorylation of ATF1 at serine 63 by CDK3 can be monitored by:

      • Phospho-specific antibodies

      • Kinase assays with wild-type and mutant (S63A) ATF1

    • This approach links CDK3 kinase activity to downstream signaling events in transformation

  • In vivo tumorigenesis assays:

    • Cells with modulated CDK3 expression can be injected into nude mice to assess tumor formation potential

    • Knockdown of ATF1 has been shown to suppress tumorigenicity and metastatic potential in nude mice, suggesting a similar approach could be valuable for CDK3

These complementary approaches provide robust validation of CDK3's role in cellular transformation across multiple experimental systems.

How can researchers accurately assess CDK3 kinase activity in experimental systems?

Accurately assessing CDK3 kinase activity requires specific methodological approaches:

  • In vitro kinase assays:

    • Immunoprecipitation: Isolate CDK3 using specific antibodies from cell lysates

    • Substrate selection: Use known CDK3 substrates (ATF1, histone H1, RB1, CABLES1)

    • Reaction conditions: Incubate with substrates in the presence of [γ-32P]ATP or non-radioactive ATP

    • Detection: Analyze by autoradiography or phospho-specific antibodies

    • Controls: Include kinase-dead CDK3 mutants as negative controls

  • Phospho-specific antibody detection:

    • Direct assessment: Use phospho-specific antibodies against CDK3 substrates (e.g., ATF1 phospho-Ser63)

    • Western blotting: Monitor changes in substrate phosphorylation states

    • Validation: Compare phosphorylation in CDK3 overexpression vs. knockdown conditions

  • Cellular reporter systems:

    • ATF1 transcriptional activity: Use reporter constructs with ATF1 binding sites

    • Phosphorylation-dependent interactions: Monitor CDK3-dependent protein interactions

    • Cell cycle progression: Assess G0-G1 and G1-S transitions as functional readouts of CDK3 activity

  • Cyclin binding and activation:

    • Co-immunoprecipitation: Analyze CDK3 interaction with cyclins (particularly cyclin-C)

    • CDK3/cyclin complex isolation: Purify active complexes for activity measurements

    • Cell cycle phase correlation: Compare activity across different cell cycle phases

  • Inhibitor studies:

    • Chemical inhibitors: Assess effects of CDK inhibitors on CDK3 activity

    • Specificity controls: Include related CDKs to establish selectivity

    • Dose-response relationships: Determine IC50 values for inhibition

These approaches, particularly when used in combination, provide robust assessment of CDK3 kinase activity in experimental systems.

What are common challenges in CDK3 antibody experiments and how can they be addressed?

Researchers working with CDK3 antibodies may encounter several challenges:

  • Weak or nonspecific signals in Western blotting:

    • Solution: Optimize antibody concentration (try 1:500-1:4000 dilution range)

    • Solution: Extend primary antibody incubation (overnight at 4°C)

    • Solution: Use enhanced chemiluminescence substrates for detection

    • Solution: Increase protein loading (30 μg recommended)

  • Cross-reactivity with other CDK family members:

    • Solution: Select antibodies raised against unique regions of CDK3

    • Solution: Validate with siRNA knockdown of CDK3

    • Solution: Confirm results with multiple antibodies targeting different epitopes

    • Solution: Include appropriate positive and negative controls

  • Variable expression levels across cell lines:

    • Solution: Use validated cell lines with confirmed CDK3 expression (HepG2, MCF-7, Jurkat, T98G)

    • Solution: Consider tissue-specific expression patterns

    • Solution: Normalize to appropriate housekeeping proteins

  • Challenges in detecting phosphorylated substrates:

    • Solution: Use phospho-specific antibodies for key substrates (e.g., ATF1 phospho-Ser63)

    • Solution: Include phosphatase inhibitors in lysis buffers

    • Solution: Compare samples with and without CDK3 inhibition or knockdown

  • Inconsistent IHC/IF staining:

    • Solution: Optimize antigen retrieval (TE buffer pH 9.0 or citrate buffer pH 6.0)

    • Solution: Test different fixation methods

    • Solution: Adjust antibody concentration (1:50-1:400 for IHC, 1:200-1:800 for IF)

  • Difficulties in co-immunoprecipitation experiments:

    • Solution: Use mild lysis conditions to preserve protein interactions

    • Solution: Consider cross-linking to stabilize transient interactions

    • Solution: Verify interaction with proximity ligation assay

By implementing these solutions, researchers can significantly improve the reliability and reproducibility of their CDK3 antibody experiments.

What controls should be included in experiments investigating CDK3 function and expression?

When investigating CDK3 function and expression, the following controls are essential for rigorous and reproducible research:

  • Antibody specificity controls:

    • Positive controls: Cell lines with known CDK3 expression (HepG2, MCF-7, Jurkat, T98G)

    • Negative controls: CDK3 knockdown or knockout samples

    • Peptide competition: Pre-incubation of antibody with immunizing peptide

    • Secondary antibody only: To assess background signal

  • Expression manipulation controls:

    • Empty vector: For overexpression studies

    • Scrambled siRNA (si-mock): For knockdown experiments

    • Rescue experiments: CDK3 re-expression in knockdown cells using siRNA-resistant constructs

    • Dose dependency: Multiple levels of expression or knockdown

  • Functional/activity controls:

    • Kinase-dead mutants: For enzymatic activity studies

    • Phospho-deficient substrates: e.g., ATF1 S63A mutant

    • Cell cycle synchronization: To control for cell cycle effects

    • Inhibitor controls: Specific CDK inhibitors versus broad-spectrum kinase inhibitors

  • Experimental technique controls:

    • Loading controls: Housekeeping proteins (β-actin, GAPDH) for Western blots

    • IHC/IF controls: Isotype controls, known positive and negative tissues

    • IP controls: IgG control, input samples (5-10% of lysate)

    • Proximity ligation controls: Single antibody controls, known interacting proteins

  • Biological response controls:

    • Cell proliferation: Positive and negative regulators

    • Cell transformation: Known oncogenes (e.g., Ras^G12V) and tumor suppressors

    • In vivo studies: Vehicle control, positive control treatments

Including these comprehensive controls significantly enhances the reliability and interpretability of experiments investigating CDK3 function and expression.

What are emerging areas of CDK3 research that could benefit from improved antibody-based methodologies?

Several emerging research areas could benefit from improved CDK3 antibody methodologies:

  • Single-cell analysis of CDK3 expression and activity:

    • Development of highly sensitive antibodies for low-abundance detection

    • Compatibility with single-cell proteomics and phosphoproteomics

    • Integration with spatial transcriptomics data

  • CDK3 as a therapeutic target in cancer:

    • Antibodies for patient stratification based on CDK3 expression

    • Monitoring response to CDK inhibitors in clinical samples

    • Developing CDK3-specific inhibitors through structural studies

  • PTP1B-CDK3 signaling axis in cancer progression:

    • Improved proximity ligation assays to map interaction domains

    • Antibodies to detect specific phosphorylation states of CDK3

    • Methods to assess activation mechanisms independent of CDC25

  • CDK3 in cell cycle regulation beyond G0-G1 and G1-S transitions:

    • Phase-specific antibodies to track CDK3 localization throughout the cell cycle

    • Improved immunofluorescence protocols for co-localization studies

    • Phospho-specific antibodies for cell cycle-dependent substrates

  • Development of CDK3 biomarkers for cancer prognosis:

    • Standardized IHC protocols for clinical sample analysis

    • Multiplex immunofluorescence to assess CDK3 and substrate activation

    • Correlation with patient outcomes in various cancer types

These emerging areas will require continued refinement of antibody technologies, including:

  • Higher specificity antibodies distinguishing CDK3 from other CDK family members

  • Improved phospho-specific antibodies for key substrates

  • Compatible protocols for clinical samples and advanced imaging techniques

  • Antibody formats suitable for multiplexed detection systems

Advancing these methodologies will accelerate our understanding of CDK3's roles in normal physiology and disease pathogenesis.

How might rapid antibody discovery technologies improve CDK3-focused research?

Recent advances in rapid antibody discovery technologies offer significant potential to improve CDK3-focused research:

  • Microfluidics-enabled antibody discovery:

    • Recent technology has demonstrated rapid discovery of monoclonal antibodies by screening millions of mouse and human antibody-secreting cells (ASCs)

    • This approach has yielded antibodies with extraordinarily high affinity (<1 pM) and functionality in just 2 weeks

    • Applied to CDK3 research, this could generate highly specific antibodies targeting unique epitopes or post-translational modifications

  • Benefits for CDK3 research:

    • Higher specificity: Improved distinction between CDK3 and other CDK family members

    • Post-translational modification detection: Better antibodies against specific phosphorylation states

    • Expanded application range: Antibodies optimized for multiple techniques (WB, IHC, IF, IP)

    • Increased sensitivity: Detection of lower abundance CDK3 in primary tissues

  • Potential applications:

    • Conformational antibodies: Detecting active versus inactive CDK3 states

    • Interaction-specific antibodies: Recognizing CDK3-cyclin complexes

    • Species-specific variants: Better tools for animal models

    • Therapeutic development: Potential for CDK3-targeting biologics

  • Integration with other technologies:

    • Combination with CRISPR screens to validate CDK3 pathways

    • Pairing with proteomics to discover new CDK3 substrates

    • Application in high-content imaging for pathway analysis

    • Development of biosensors for real-time CDK3 activity monitoring

The high hit rates (>85% binding) and rapid development timeline (2 weeks) offered by these new technologies could significantly accelerate CDK3 research by providing more precise tools for investigating its diverse cellular functions and potential as a therapeutic target .

By facilitating access to the underexplored antibody-secreting cell compartment, these approaches enable more efficient antibody discovery and could drive new immunological studies into CDK3's roles in cell cycle regulation and cancer progression .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.