cfap157 Antibody

What is CFAP157 and what cellular functions does it perform?

CFAP157, also known as chromosome 9 open reading frame 117 (c9orf117), is a protein encoded by the CFAP157 gene in humans. This protein plays a crucial role in ciliary and flagellar biology, specifically during spermatogenesis. According to UniProt annotations, CFAP157 is "specifically required during spermatogenesis for flagellum morphogenesis and sperm motility and may be required to suppress the formation of supernumerary axonemes and ensure a correct ultrastructure" . The protein is primarily composed of α-helices without transmembrane domains, suggesting its role as a structural or regulatory component rather than a membrane protein . Understanding this basic function is essential for researchers designing experiments to investigate ciliary or flagellar dysfunction, particularly in reproductive biology contexts.

Where is the CFAP157 gene located and what are its key features?

The CFAP157 gene is located on human chromosome 9 at position 9q34.11, spanning from base pair 127,706,989 to base pair 127,716,002 . The gene encompasses 9,013 bases on the plus strand and contains 9 exons . The most common mRNA variant contains 1,722 base pairs, which encodes a protein of 520 amino acids . This genomic information is particularly valuable for researchers designing gene-targeting approaches or investigating genomic variations that might affect CFAP157 expression or function. When designing primers for gene expression studies, this precise genomic location information should guide appropriate design strategies.

What is the expression pattern of CFAP157 in human tissues?

CFAP157 shows a multi-tissue expression pattern in humans. It is expressed in several body tissues including cervix, lung, testis, and uterus . This expression has been documented in both adult and fetal tissues . Interestingly, altered CFAP157 expression has been associated with uterine tumors, suggesting potential pathological implications beyond its normal physiological role . When designing tissue-specific experiments, researchers should consider this expression pattern to select appropriate positive and negative control tissues for antibody validation experiments.

What are the validated applications for commercial CFAP157 antibodies?

Commercial CFAP157 antibodies, such as the rabbit polyclonal antibody available from Sigma-Aldrich (HPA021786), have been validated for specific research applications. According to the product information, this antibody has been validated for immunofluorescence at concentrations of 0.25-2 μg/mL and immunohistochemistry at dilutions of 1:1000-1:2500 . The antibody has undergone enhanced validation through orthogonal RNAseq as part of the Human Protein Atlas project, providing additional confidence in its specificity . Researchers should be aware that application-specific optimization may still be necessary despite these recommended concentrations, particularly when working with unique tissue types or experimental conditions.

How should sample preparation be optimized for CFAP157 immunostaining?

For optimal immunostaining results with CFAP157 antibodies, researchers should carefully consider fixation and permeabilization protocols. While specific optimization recommendations for CFAP157 are not explicitly mentioned in the search results, general antibody principles apply. Fixation with 4% paraformaldehyde typically preserves protein epitopes while maintaining cellular architecture. Given CFAP157's role in flagellar structures, researchers may need to use specialized fixation protocols to preserve delicate ciliary structures. When working with tissues expressing CFAP157 (cervix, lung, testis, uterus), tissue-specific optimization may be necessary to balance antigen preservation with tissue penetration of the antibody.

How can researchers validate CFAP157 antibody specificity?

Antibody specificity validation for CFAP157 should follow a multi-method approach. First, researchers should perform western blot analysis to confirm detection of a protein band at the expected molecular weight of approximately 60.5 kDa . Second, immunostaining patterns should correlate with known expression patterns in tissues such as testis, uterus, lung, and cervix . For definitive validation, researchers can use genetic approaches such as CRISPR-Cas9 mediated knockout of CFAP157, siRNA knockdown, or analysis of tissues from CFAP157-deficient models.

The orthogonal validation approach, as mentioned in the Sigma product information, compares protein detection with transcript levels . This method can provide additional confidence that the antibody is specifically detecting CFAP157. For example, if RNA-sequencing data shows high expression in testis and low expression in liver, antibody staining should show a similar pattern to be considered specific.

What experimental controls should be included in CFAP157 antibody experiments?

For rigorous CFAP157 antibody experiments, researchers should include multiple controls:

• Positive tissue controls: Samples known to express CFAP157 (testis, uterus, cervix, lung)

• Negative tissue controls: Samples with minimal CFAP157 expression

• Peptide competition: Pre-incubation of antibody with immunogen peptide should abolish specific staining

• Technical negative controls: Omission of primary antibody

• Isotype controls: Use of isotype-matched non-specific rabbit IgG

For advanced validation, genetic controls including CFAP157 knockout or knockdown models provide the most definitive specificity confirmation. When interpreting results, researchers should consider that CFAP157 is primarily α-helical in structure , which may influence epitope accessibility under different experimental conditions.

How does the immunogen sequence affect antibody performance?

The immunogen sequence used to generate an antibody significantly impacts its performance. For the Sigma CFAP157 antibody, the immunogen sequence is:
"DNQALKSQRDQLSLQLEQQQVDLQRLQQELANEQKVRASLEAALVQATSFLQNILQMHRDEEDSDVDVTFQPWHKEMLQQLLVMLSST" .

This sequence represents a specific region of the CFAP157 protein. Researchers should note that this sequence may affect:

• Epitope accessibility in different applications (western blot versus immunohistochemistry)

• Potential cross-reactivity with similar epitopes in other proteins

• Performance in detecting different isoforms or post-translationally modified forms of CFAP157

When troubleshooting antibody performance issues, researchers should consider whether experimental conditions might affect the conformation or accessibility of this specific epitope region.

What methodological approaches are optimal for studying CFAP157 localization?

To study CFAP157 localization effectively, researchers should employ a multi-method approach:

• Immunofluorescence microscopy: Using validated antibodies at recommended concentrations (0.25-2 μg/mL) to visualize cellular distribution.

• Co-localization studies: Combining CFAP157 antibodies with markers for cilia, basal bodies, or flagellar structures to define precise subcellular localization.

• Super-resolution microscopy: For detailed examination of CFAP157 within ciliary or flagellar structures.

• Immuno-electron microscopy: For ultrastructural localization within axonemal structures.

• Fractionation studies: Biochemical approaches to isolate ciliary/flagellar fractions and confirm CFAP157 presence by western blotting.

Given CFAP157's role in flagellar morphogenesis and sperm motility, researchers should design experiments that can examine both the protein's static localization and its potential dynamic behavior during ciliary/flagellar development or function.

How can researchers design experiments to investigate CFAP157 function?

To investigate CFAP157 function, researchers can employ several complementary approaches:

• Gene silencing/knockout: CRISPR-Cas9 or siRNA approaches to reduce or eliminate CFAP157 expression, followed by phenotypic analysis focusing on ciliary/flagellar structure and function.

• Rescue experiments: Re-expression of wild-type or mutant CFAP157 in knockout cells to determine structure-function relationships.

• Protein interaction studies: Immunoprecipitation with CFAP157 antibodies followed by mass spectrometry to identify interaction partners.

• Functional assays: Measuring ciliary or flagellar parameters (length, beating frequency, ultrastructure) in the presence or absence of CFAP157.

• Disease model studies: Analysis of CFAP157 in models of ciliopathies or reproductive disorders.

These approaches should be tailored to the specific research question, with particular attention to CFAP157's reported role in suppressing supernumerary axonemes and ensuring correct flagellar ultrastructure .

How can biophysics-informed models improve CFAP157 antibody design?

Recent advances in antibody development combine high-throughput sequencing and machine learning to predict and design antibodies with customized specificity profiles . For CFAP157 research, these approaches could be particularly valuable when highly specific antibodies are needed to distinguish between CFAP157 and related proteins, or when studying specific post-translational modifications.

The biophysics-informed model approach associates distinct binding modes with potential ligands, enabling the prediction and generation of specific variants beyond those observed in experiments . This methodology could be applied to create CFAP157 antibodies with enhanced specificity or custom cross-reactivity profiles, depending on research needs. The process typically involves:

• Initial phage display experiments with antibody libraries

• High-throughput sequencing of selected antibodies

• Computational modeling to identify binding modes

• Design of novel antibody sequences with predicted specificity profiles

• Experimental validation of designed antibodies

This sophisticated approach represents the cutting edge of antibody development and could be particularly valuable for challenging research applications involving CFAP157 .

How should contradictory results with different CFAP157 antibodies be interpreted?

When faced with contradictory results using different CFAP157 antibodies, researchers should systematically investigate several factors:

• Epitope differences: Different antibodies may target distinct regions of CFAP157, which could have different accessibility in various experimental conditions or tissues.

• Validation status: Compare the validation documentation for each antibody, prioritizing those with orthogonal validation methods like the RNAseq validation reported for some commercial antibodies .

• Isoform specificity: Determine if conflicting results might reflect detection of different CFAP157 isoforms.

• Post-translational modifications: Consider whether modifications might mask or alter epitopes in specific contexts.

• Cross-reactivity: Assess potential cross-reactivity with related proteins, particularly in tissues with low CFAP157 expression.

To resolve contradictions, researchers should conduct controlled comparison experiments using genetic models (knockout/knockdown) as the gold standard for specificity determination. Peptide competition assays and western blot analysis can provide additional evidence to determine which antibody most specifically detects CFAP157.

What is known about CFAP157's potential role in disease pathology?

Current understanding of CFAP157's role in disease is limited but evolving. The search results indicate that altered CFAP157 expression has been associated with uterine tumors , suggesting a potential role in reproductive system pathologies. Given its role in flagellar morphogenesis and sperm motility , CFAP157 dysfunction may also contribute to male fertility disorders, though specific disease associations were not detailed in the provided search results.

Researchers investigating CFAP157 in disease contexts should consider:

• Designing case-control studies examining CFAP157 expression in relevant pathological specimens

• Investigating genetic variants in CFAP157 in patients with ciliopathies or fertility disorders

• Developing animal models with CFAP157 mutations to characterize phenotypes

• Examining CFAP157 expression or localization changes in response to disease-relevant stimuli

The connection between CFAP157's molecular function and disease manifestations requires further investigation, presenting opportunities for novel research contributions.

How can CFAP157 ortholog studies inform human disease research?

CFAP157 has numerous orthologs across species , providing opportunities for comparative studies to understand conserved functions and disease mechanisms. While the search results don't provide a complete list of orthologs, they mention that orthologs exist in species including chimpanzee, rhesus macaque, cattle, dog, mouse, rat, tropical clawed frog, and zebrafish .

Researchers can leverage these orthologs to:

• Conduct functional studies in model organisms where genetic manipulation may be more tractable

• Identify conserved functional domains that might be critical for CFAP157 function

• Develop animal models of CFAP157-related disorders

• Perform evolutionary analyses to identify highly conserved regions as potential therapeutic targets

Cross-species approaches can provide valuable insights, particularly for proteins involved in fundamental cellular processes like ciliogenesis, which tend to be evolutionarily conserved.