CFL2 Antibody

What is CFL2 and why is it an important research target?

Cofilin-2 (muscle), also known as CFL2, is an intracellular protein encoded by the CFL2 gene mapped to chromosome 14q12 in humans. It functions as a critical regulator of actin-filament dynamics and serves as a major component of intranuclear and cytoplasmic actin rods. CFL2 binds to both G- and F-actin in a 1:1 ratio and reversibly controls actin polymerization and depolymerization in a pH-dependent manner . Its F-actin depolymerization activity is regulated by association with CSPR3 .

CFL2 is predominantly expressed in skeletal and cardiac muscles, distinguishing it from other members of the AC group of proteins that includes cofilin-1 (CFL1) and destrin (DSTN) . It's particularly important as a research target because:

• Mutations in the CFL2 gene cause nemaline myopathy type 7, a form of congenital myopathy

• It plays a role in muscle maintenance and may be involved in the early postnatal remodeling of the sarcomere

• Recent research has identified CFL2 as an essential component in muscle development and meat quality in livestock

• Its role in skeletal muscle fiber regulation makes it relevant to both medical research and agricultural applications

What are the main applications for CFL2 antibodies in research?

CFL2 antibodies can be utilized in various laboratory techniques, with applications differing based on the specific antibody format and experimental requirements:

For optimal results, researchers should:

• Determine the specific application needs before selecting an antibody

• Verify that the chosen antibody has been validated for the specific application

• Consider the species reactivity requirements (human, mouse, rat)

• Titrate the antibody to determine optimal working concentration for each specific experimental setup

• Consider the cellular localization of CFL2 (cytoplasmic, sometimes nuclear) when designing experiments

Monoclonal Antibodies:

• Produced from a single B-cell clone, recognizing a single epitope on CFL2

• Example: CFL2 Antibody (clone 8C13)

• Advantages: High specificity, batch-to-batch consistency, reduced background

• Disadvantages: May be more sensitive to epitope changes due to protein modifications

• Best used for: Applications requiring high specificity and reproducibility, such as flow cytometry or when studying specific protein domains

Polyclonal Antibodies:

• Produced from multiple B-cell clones, recognizing multiple epitopes on CFL2

• Examples: Anti-CFL2 polyclonal antibody from Abcam, Atlas Antibodies, Elabscience

• Advantages: Robust signal detection, less affected by minor protein changes/denaturation

• Disadvantages: May have higher batch-to-batch variability

• Best used for: Western blotting, applications where protein denaturation occurs, or when signal amplification is needed

Selection considerations:

• Research question specificity: Use monoclonal for targeting specific epitopes; use polyclonal for detecting proteins that may undergo post-translational modifications

• Application sensitivity requirements: Polyclonals may provide stronger signals in techniques like Western blotting

• Reproducibility needs: For long-term studies requiring consistent results, monoclonals offer better reproducibility

• Species cross-reactivity requirements: Check validated reactivity with target species (human, mouse, rat)

How should CFL2 antibodies be properly stored and handled to maintain their effectiveness?

Proper storage and handling of CFL2 antibodies are critical for maintaining their effectiveness and ensuring experimental reproducibility. Based on manufacturer recommendations and best practices:

Storage Conditions:

• Lyophilized antibodies: Store at -20°C or -80°C until reconstitution

• Reconstituted antibodies:

  • Short-term (up to one month): 4°C

  • Long-term: Aliquot and store at -20°C

  • Some products may be stored at 2°C to 8°C for short periods

• Avoid repeated freeze-thaw cycles which can lead to protein denaturation and loss of activity

Handling Guidelines:

• Reconstitute lyophilized antibodies using recommended buffers (typically sterile DI water for products like RQ5498)

• After reconstitution, prepare small aliquots to minimize freeze-thaw cycles

• When thawing, allow the antibody to reach room temperature naturally before use

• Briefly centrifuge vials after thawing to collect all material at the bottom

• Handle antibodies using sterile technique to prevent contamination

• Follow manufacturer's recommendations for specific products, as some may have unique handling requirements

Working Solution Preparation:

• Dilute antibodies using appropriate buffers recommended by the manufacturer

• For western blotting: typical dilutions range from 1:500-1:3000

• For immunohistochemistry: typical dilutions range from 1:50-1:500

• For immunofluorescence: typical dilutions range from 1:100-1:1000

• Store working dilutions at 4°C and use within 24 hours for best results

Following these storage and handling guidelines will help ensure antibody stability and maintain experimental consistency.

How can I properly validate a CFL2 antibody for my specific research application?

Proper validation of CFL2 antibodies is essential for ensuring experimental rigor and reproducibility. A comprehensive validation approach should include:

Literature and Resource Evaluation:

• Review validation data from antibody providers

• Check databases that provide information about validated antibodies (Table 1 in source 16)

• Search for publications that have used the same antibody for similar applications

Critical Controls:

• Positive controls: Use tissues/cells known to express CFL2 (skeletal muscle, cardiac tissue, cell lines like L02, Raji, 293T)

• Negative controls:

  • No primary antibody control (secondary antibody only)

  • Isotype control (irrelevant antibody of same isotype)

  • If available, CFL2 knockout or knockdown samples

• Competition assay: Pre-incubate antibody with immunizing peptide prior to staining

Application-Specific Validation:

For Western Blot:

• Verify band appears at expected molecular weight (19 kDa for CFL2)

• Test multiple sample types (human, mouse, rat if cross-reactivity claimed)

• Include loading controls and molecular weight markers

For Immunohistochemistry/Immunofluorescence:

• Compare staining pattern to known CFL2 localization (cytoplasmic, sometimes nuclear)

• Test multiple fixation methods to determine optimal conditions

• Include blocking peptide controls

For Flow Cytometry:

• Perform antibody titration (protocol detailed in source 13)

• Create titration curves comparing stain index to antibody concentrations

• Test on both positive and negative populations

Cross-Validation:

• Validate results using multiple antibodies targeting different epitopes of CFL2

• Correlate protein detection with mRNA expression data

• Confirm specificity through genetic approaches (siRNA knockdown, CRISPR knockout)

Documentation:

• Document all validation methods, controls, and results thoroughly

• Record specific conditions (antibody lots, dilutions, incubation times/temperatures)

• Maintain detailed protocols to ensure reproducibility

This systematic approach to validation will help ensure reliable and reproducible results in CFL2 research applications.

What are the best practices for optimizing CFL2 antibody titration in flow cytometry experiments?

Flow cytometry experiments with CFL2 antibodies require careful titration to ensure optimal signal-to-noise ratio and accurate results. The following protocol is recommended based on established guidelines:

Materials Needed:

• CFL2 antibody labeled with appropriate fluorochrome

• Phosphate buffered saline (PBS) without calcium or magnesium containing 1% bovine serum albumin

• Cell suspension (1-5 × 10^6 cells/mL) that contains both CFL2-positive and CFL2-negative populations

• Round-bottom tubes for flow cytometry

• Centrifuge and flow cytometer

Titration Protocol:

• Prepare serial dilutions of the antibody:

  • Label 9 tubes numbered 1-9

  • Add 50 μL of staining buffer to each tube

  • Add 50 μL of CFL2 antibody at 4× manufacturer's recommended concentration to tube 1

  • Mix well and transfer 50 μL from tube 1 to tube 2

  • Continue serial dilution through tube 7, then discard 50 μL from tube 7

• Add cells to the antibody dilutions:

  • Add 100 μL of cell suspension to all tubes

  • Mix well and incubate for 30 minutes at room temperature in the dark

  • Wash cells three times with 2 mL of staining buffer

  • Centrifuge for 5 minutes at 300 × g, 4°C

  • Remove supernatant, vortex pellet, and resuspend in 200 μL of staining buffer

• Analyze by flow cytometry:

  • Acquire data on both positive and negative populations

  • Calculate the stain index for each dilution using the formula:
    SI = (MFI positive - MFI negative) / (2 × SD of negative population)

  • Plot antibody concentration versus stain index

• Determine optimal concentration:

  • The optimal antibody concentration corresponds to the maximum stain index

  • If no clear saturation plateau is observed, the antibody may have low affinity and results should be interpreted with caution

Additional Considerations:

• Perform titration under the same experimental conditions that will be used in the final experiment

• For multicolor panels, titrate each antibody individually and then again when combined

• Repeat titrations when changing any experimental parameters (fixation methods, staining buffers, etc.)

• For CFL2 specifically, include skeletal muscle cells or cell lines known to express CFL2 (L02, Raji)

• Document all titration results for future reference and reproducibility

Optimal titration ensures reliable separation between positive and negative populations, minimizes background, and provides cost-effective usage of antibodies in flow cytometry experiments .

What controls should be included when using CFL2 antibodies in different experimental applications?

Proper controls are essential for ensuring the validity and reliability of experiments using CFL2 antibodies. Different applications require specific controls:

For Western Blotting:

• Positive Control:

  • Lysates from tissues/cells known to express CFL2 (skeletal muscle, cardiac tissue, L02 cells, Raji cells)

  • Recombinant CFL2 protein of known concentration

• Negative Control:

  • If available, CFL2 knockout or knockdown samples

  • Tissues/cells known not to express CFL2

• Loading Control:

  • Housekeeping proteins (GAPDH, β-actin, tubulin) to normalize protein loading

• Molecular Weight Marker:

  • To confirm the detected band appears at expected molecular weight (19 kDa for CFL2)

• Secondary Antibody Control:

  • Membrane processed with secondary antibody only (no primary) to detect non-specific binding

For Immunohistochemistry/Immunofluorescence:

• Antibody Controls:

  • Primary antibody alone (no secondary) to assess autofluorescence/background

  • Secondary antibody alone (no primary) to detect non-specific binding

  • Isotype control (irrelevant antibody of same isotype and concentration)

• Tissue/Cell Controls:

  • Positive control tissues (skeletal muscle, heart tissue)

  • Negative control tissues (tissues known not to express CFL2)

• Blocking Peptide Control:

  • Pre-incubate antibody with immunizing peptide prior to staining

  • Should abolish specific staining if antibody is specific

• Counterstaining:

  • Nuclear counterstain (DAPI, Hoechst) to confirm cellular localization

  • Phalloidin staining (for actin) may be useful as CFL2 interacts with actin filaments

For Flow Cytometry:

• Antibody Controls:

  • Unstained cells to establish autofluorescence baseline

  • Isotype control to determine non-specific binding

  • Fluorescence minus one (FMO) controls for multicolor panels

• Cell Controls:

  • Positive cell population (cells known to express CFL2)

  • Negative cell population (cells known not to express CFL2)

  • Single-stained compensation controls for multicolor panels

For All Applications:

• Technical Replicates:

  • Multiple runs of the same experiment to ensure reproducibility

• Biological Replicates:

  • Different biological samples to account for natural variation

• Validation Controls:

  • Orthogonal methods to confirm findings (e.g., mRNA expression, different antibodies targeting different epitopes)

Including these controls allows for rigorous validation of results and helps distinguish true signals from artifacts, ensuring scientific integrity in CFL2 research .

How do mutations in the CFL2 gene affect antibody recognition and what considerations should be made when studying disease models?

Mutations in the CFL2 gene can significantly impact antibody recognition, particularly in the context of nemaline myopathy type 7 and other myopathic conditions. Researchers studying disease models should be aware of these challenges:

Impact of CFL2 Mutations on Antibody Recognition:

• Epitope Alterations:

  • Missense mutations (like the p.A35T mutation) can directly alter the epitope structure recognized by antibodies

  • The G103A mutation associated with nemaline myopathy potentially changes protein conformation

  • These alterations may reduce or eliminate antibody binding, leading to false negative results

• Protein Expression Changes:

  • Mutations can affect mRNA splicing and protein expression levels

  • The p.A35T mutation significantly decreases CFL2 mRNA and full-length transcript levels in skeletal muscles

  • Reduced protein expression may result in weaker antibody signals that could be misinterpreted

• Altered Protein Localization:

  • Some mutations can change the subcellular localization of CFL2

  • This may result in unexpected staining patterns in immunohistochemistry or immunofluorescence studies

Considerations for Disease Model Studies:

• Antibody Selection Strategy:

  • Choose antibodies targeting epitopes distant from known mutation sites

  • Consider using multiple antibodies targeting different regions of CFL2

  • For the common p.A35T mutation, avoid antibodies with epitopes encompassing residue 35

  • The immunogen for the CFL2 antibody (8C13) contains amino acids KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKL, which should be checked against known mutation sites

• Validation in Disease Models:

  • Validate antibodies specifically in the disease model being studied

  • Compare antibody performance in wild-type vs. mutant samples

  • Include RNA analysis (RT-PCR) as done in studies of the p.A35T mutation to correlate with protein detection

  • Consider Western blot for size verification alongside immunohistochemistry studies

• Alternative Detection Methods:

  • Supplement antibody-based detection with mRNA quantification

  • Use genetic tagging approaches where possible

  • Consider mass spectrometry for protein identification and quantification

  • When studying the splicing alterations observed with some CFL2 mutations, use primers spanning multiple exons

• Control Recommendations:

  • Use tissues from both affected and unaffected individuals

  • Include samples from heterozygous carriers when available

  • Use genetically modified models (like the CFL2 p.A35T knockin mouse) as reference standards

  • When interpreting results, consider the specific mutation's predicted effect on protein structure and function

By carefully considering these factors, researchers can ensure more accurate and reliable results when studying CFL2 mutations in disease models.

What are the key differences between various commercially available CFL2 antibodies and how should researchers choose the most appropriate one?

Selecting the most appropriate CFL2 antibody requires careful consideration of several factors. Here's a comparison of key commercially available CFL2 antibodies and selection guidance:

Comparison of Commercial CFL2 Antibodies:

Selection Criteria for Researchers:

• Research Application Requirements:

  • For Western blot: Most antibodies perform well; consider Proteintech 11848-1-AP (validated in publications)

  • For IHC/IF: Consider antibodies specifically validated for these applications with clear cellular localization data

  • For flow cytometry: Limited options; NSJ Bioreagents RQ5498 is specifically validated

• Species Considerations:

  • For human samples: All listed antibodies are reactive

  • For mouse/rat studies: Avoid Abcam ab96678 (human-specific); choose antibodies validated for rodent reactivity

• Antibody Format Needs:

  • For reproducibility in long-term studies: Consider monoclonal (NSJ Bioreagents RQ5498)

  • For sensitive detection: Consider polyclonal antibodies

• Validation Evidence:

  • Check for published validation data and citations

  • Review manufacturer validation images for your specific application

  • Abcam ab96678 is cited in 5 publications; Proteintech 11848-1-AP has published applications

• Epitope Considerations:

  • For studies involving mutations: Choose antibodies with epitopes distant from mutation sites

  • For specific domain studies: Select antibodies targeting relevant regions

• Technical Support:

  • Consider manufacturers that provide detailed protocols and responsive technical support

  • Look for companies offering satisfaction guarantees

• Budget Considerations:

  • Prices vary significantly (e.g., NSJ Bioreagents RQ5498: $439 for 100 μg; Aviva OAGA01036: $489 for 100 μL)

  • Consider cost-effectiveness based on antibody concentration and application needs

Researchers should review the manufacturer's validation data, check literature citations, and when possible, evaluate antibody performance in their specific experimental system before making a final selection.

What are common troubleshooting strategies for experiments using CFL2 antibodies?

When experiments with CFL2 antibodies don't yield expected results, systematic troubleshooting can help identify and resolve issues. Here are comprehensive strategies organized by common problems:

No Signal or Weak Signal:

Western Blotting:

• Increase antibody concentration (try 1:500 instead of 1:2000 for polyclonal antibodies)

• Extend primary antibody incubation time (overnight at 4°C)

• Ensure sufficient protein loading (15-30 μg total protein)

• Use more sensitive detection reagents (ECL Plus instead of standard ECL)

• Check transfer efficiency with reversible staining (Ponceau S)

• Verify sample preparation (protease inhibitors, proper lysis buffer)

• Consider CFL2 expression levels in your sample (skeletal muscle has higher expression)

Immunohistochemistry/Immunofluorescence:

• Optimize antigen retrieval (try both citrate buffer pH 6.0 and TE buffer pH 9.0)

• Increase antibody concentration (use 1:50 dilution for IHC)

• Extend incubation time (overnight at 4°C)

• Try different fixation methods (paraformaldehyde vs. methanol)

• Use amplification systems (tyramide signal amplification)

• Minimize washing steps or reduce washing stringency

High Background or Non-specific Staining:

Western Blotting:

• Increase blocking time (2 hours at room temperature)

• Use alternative blocking reagents (5% BSA instead of milk)

• Increase washing frequency and duration

• Dilute primary antibody further

• Prepare fresh buffers and reagents

• Use validated secondary antibodies at appropriate dilutions

Immunohistochemistry/Immunofluorescence:

• Increase blocking time and concentration (3% BSA for 2 hours)

• Add 0.1-0.3% Triton X-100 for better penetration and reduced background

• Include additional blocking steps (serum from secondary antibody host species)

• Ensure tissue sections are not too thick

• Use directly labeled primary antibodies to eliminate secondary antibody issues

• Pre-absorb antibodies with tissue powder if cross-reactivity is suspected

Multiple or Unexpected Bands in Western Blot:

• Verify expected molecular weight (19 kDa for CFL2)

• Check for post-translational modifications or isoforms

• Use gradient gels for better separation

• Include reducing agents (DTT or β-mercaptoethanol) in sample buffer

• Optimize sample preparation to prevent protein degradation

• Run positive control (recombinant CFL2) alongside samples

• Consider alternative antibodies targeting different epitopes

• Be aware of alternative splicing producing a 357 bp transcript in addition to the full-length 611 bp transcript

Inconsistent Results Between Experiments:

• Standardize protocols rigorously

• Aliquot antibodies to avoid freeze-thaw cycles

• Use consistent cell/tissue sources and preparation methods

• Maintain detailed records of antibody lots and concentrations

• Include internal controls in each experiment

• Standardize image acquisition parameters

• Perform antibody titration for each new lot

Discrepancies Between Antibody-Based and mRNA-Based Results:

• Consider post-transcriptional regulation

• Check antibody specificity with knockout controls if available

• Verify protein half-life (stable proteins may persist despite low mRNA)

• Evaluate subcellular localization (protein may be compartmentalized)

• For CFL2 mutations specifically, check for altered splicing patterns and decreased full-length transcripts

Flow Cytometry-Specific Issues:

• Perform proper antibody titration (see question 6)

• Include viable cell gating to exclude dead cells (which cause non-specific binding)

• Optimize fixation/permeabilization for intracellular staining

• Use compensation controls for multicolor experiments

• Consider alternative fluorophores if signal overlap is an issue

Each troubleshooting approach should be methodically documented and tested individually to identify the source of the problem. Consulting the antibody manufacturer's technical support can also provide application-specific recommendations.

How does post-translational modification of CFL2 affect antibody detection and what strategies can mitigate these challenges?

Post-translational modifications (PTMs) of CFL2 can significantly impact antibody detection and experimental outcomes. Understanding these effects and implementing appropriate strategies is crucial for accurate research results.

Common Post-translational Modifications of CFL2:

• Phosphorylation:

  • CFL2, like cofilin-1, can be phosphorylated, primarily at Ser3

  • Phosphorylation inactivates CFL2's actin-binding capability

  • CFL2 works closely with LIM kinase (which phosphorylates cofilin) and slingshot phosphatase (which dephosphorylates and activates it)

• Oxidation:

  • Oxidative stress can lead to oxidation of cysteine and methionine residues

  • May alter protein conformation and epitope accessibility

• Ubiquitination:

  • Can target CFL2 for proteasomal degradation

  • May mask epitopes or create additional bands on Western blots

• Glycosylation:

  • Potential N-linked glycosylation can affect protein migration and epitope recognition

Impact on Antibody Detection:

• Epitope Masking:

  • PTMs can directly block antibody binding sites

  • Phosphorylation at Ser3 may interfere with N-terminal targeting antibodies

• Conformational Changes:

  • PTMs can alter protein folding, affecting conformational epitopes

  • May result in reduced antibody affinity or complete loss of binding

• Migration Pattern Alterations:

  • Phosphorylation and other PTMs can change protein mobility in SDS-PAGE

  • Can lead to unexpected band patterns in Western blots

  • May cause confusion with splice variants or proteolytic fragments

• Subcellular Localization Changes:

  • PTMs can alter CFL2 localization (e.g., phosphorylation affects nuclear/cytoplasmic distribution)

  • May lead to unexpected staining patterns in immunofluorescence/IHC

Mitigation Strategies:

• Antibody Selection:

  • Use antibodies targeting epitopes unlikely to be affected by known PTMs

  • Consider phospho-specific antibodies when studying CFL2 activation state

  • For comprehensive studies, use multiple antibodies targeting different regions

• Sample Preparation:

  • Include phosphatase inhibitors in lysis buffers to preserve phosphorylation states

  • Add protease inhibitors to prevent degradation

  • Use reducing agents to maintain cysteine residues in reduced state

  • Consider native vs. denaturing conditions based on epitope characteristics

• Complementary Techniques:

  • Use Phos-tag™ SDS-PAGE to separate phosphorylated from non-phosphorylated forms

  • Employ 2D gel electrophoresis to separate PTM variants

  • Confirm antibody results with mass spectrometry to identify specific PTMs

  • Treat samples with phosphatases to confirm phosphorylation-dependent effects

• Controls and Validation:

  • Use recombinant CFL2 with defined PTM status as controls

  • Include samples treated with kinase or phosphatase inhibitors

  • When studying disease models, compare PTM patterns between normal and pathological samples

  • Validate findings using orthogonal detection methods

• Data Interpretation:

  • Account for potential PTM effects when interpreting unexpected results

  • Consider the biological context and conditions that might alter PTM status

  • Document all experimental conditions that might affect PTM status

By understanding how PTMs affect CFL2 detection and implementing these strategies, researchers can obtain more accurate and reliable results when studying this important cytoskeletal regulator.

What are the latest methodological advances in studying CFL2 using antibody-based techniques?

Recent technological and methodological advances have enhanced the precision, sensitivity, and applications of antibody-based techniques for studying CFL2. These innovations provide researchers with powerful new tools for investigating this important cytoskeletal regulator.

Advanced Imaging Techniques:

• Super-Resolution Microscopy:

  • Techniques like STORM, PALM, and STED overcome the diffraction limit

  • Allow visualization of CFL2 interaction with actin filaments at nanometer resolution

  • Enable detailed study of CFL2 localization within sarcomeres of skeletal muscle

  • Particularly valuable for studying nemaline rod formation in CFL2-related myopathies

• Live-Cell Imaging:

  • Fluorescently tagged antibody fragments (Fabs) for live-cell CFL2 tracking

  • CRISPR-based tagging combined with antibody detection for endogenous CFL2 visualization

  • Allows real-time monitoring of CFL2 dynamics during actin remodeling

• Proximity Ligation Assay (PLA):

  • Detects protein-protein interactions between CFL2 and binding partners

  • Useful for studying CFL2 interaction with actin, LIMK, and slingshot phosphatase in situ

  • Provides higher sensitivity than conventional co-immunoprecipitation

Quantitative Approaches:

• Automated High-Content Analysis:

  • Machine learning algorithms for quantifying CFL2 localization patterns

  • High-throughput screening of compounds affecting CFL2 function

  • Standardized analysis reducing observer bias in image interpretation

• Mass Cytometry (CyTOF):

  • Antibodies labeled with rare earth metals instead of fluorophores

  • Allows simultaneous detection of CFL2 alongside dozens of other proteins

  • Eliminates spectral overlap issues of conventional flow cytometry

  • Valuable for analyzing CFL2 in complex tissue samples like skeletal muscle

• Single-Cell Western Blotting:

  • Quantification of CFL2 levels in individual cells

  • Reveals cell-to-cell variability masked in conventional Western blots

  • Particularly useful for heterogeneous tissues or mixed cell populations

Artificial Intelligence Applications:

• AI-Enhanced Antibody Development:

  • Machine learning algorithms predict optimal epitopes for CFL2 antibody generation

  • AI systems trained on antibody sequences can identify off-targets as soon as sequences are known

  • Does not require knowledge of antigen's 3D structure

• Deep Learning for Antibody Validation:

  • Trained models can distinguish between genuine and non-specific antibody binding patterns

  • Enhances reliability of CFL2 detection in complex tissues

  • Recent models have been trained to distinguish between antibodies to different proteins with high accuracy

Multiplexed Detection Systems:

• Multiplex Immunohistochemistry/Immunofluorescence:

  • Tyramide signal amplification allowing detection of multiple targets

  • Simultaneous visualization of CFL2 alongside other cytoskeletal proteins

  • Cyclic immunofluorescence techniques for detecting 20+ proteins on the same tissue section

• Spatial Transcriptomics Combined with Antibody Detection:

  • Correlation of CFL2 protein levels with mRNA expression in the same tissue section

  • Particularly valuable for studying splicing alterations observed in CFL2 mutations

  • Enables investigation of post-transcriptional regulation mechanisms

Genetic-Antibody Hybrid Approaches:

• CRISPR Knock-in Models for Antibody Validation:

  • Generation of epitope-tagged CFL2 for absolute antibody specificity

  • Knockin mouse models like CFL2 p.A35T provide validated tools for antibody testing

  • Allows testing of antibodies against disease-relevant mutations

• Intrabodies and Nanobodies:

  • Development of single-domain antibodies that function in intracellular environments

  • Can be used to track or modulate CFL2 function in living cells

  • Smaller size allows access to epitopes unavailable to conventional antibodies

These methodological advances are expanding our understanding of CFL2 function in normal physiology and disease states, particularly in skeletal muscle development and myopathies. Researchers can leverage these techniques to gain deeper insights into CFL2 biology and its role in actin dynamics.