CLB1 Antibody

What is CLCC1 and why is it significant as a research target?

CLCC1 (Chloride Channel CLIC-like protein 1) is an anion-selective channel with calcium-dependent and voltage-independent gating properties. It functions primarily in the endoplasmic reticulum (ER) membrane where it mediates chloride efflux to compensate for positive charge loss during calcium release from the ER lumen . The significance of CLCC1 as a research target stems from its crucial role in maintaining ER calcium pools and activating the unfolded protein response (UPR), which prevents misfolded protein accumulation in the ER lumen .

CLCC1 is particularly important in ER homeostasis mechanisms that underlie the survival of motor neurons and retinal photoreceptors, making it a valuable target for neurological and ophthalmological research . Understanding CLCC1 function through antibody-based techniques provides insights into fundamental cellular processes related to ER stress, protein folding, and ion channel regulation - all of which have implications for multiple disease states.

What applications are CLCC1 antibodies suitable for in research settings?

CLCC1 antibodies are versatile tools that have been validated for multiple research applications. According to available data, commercially available CLCC1 antibodies are suitable for:

• Immunohistochemistry on paraffin-embedded tissues (IHC-P) with recommended dilutions of 1:200-1:500

• Western blotting (WB) for protein detection and quantification

• Immunoprecipitation (IP) for protein-protein interaction studies

• Immunocytochemistry/Immunofluorescence (ICC/IF) with recommended concentrations of 0.25-2 μg/mL for subcellular localization studies

These applications enable researchers to investigate CLCC1 expression, localization, and interactions across different experimental contexts. The antibodies have been particularly well-characterized for human samples, though cross-reactivity with other species may be possible based on sequence homology .

How should researchers select the appropriate CLCC1 antibody format for their experiments?

Selecting the appropriate CLCC1 antibody format requires consideration of several experimental factors:

Antibody Format Considerations:

• Polyclonal antibodies (such as the rabbit polyclonal CLCC1 antibody) provide high sensitivity by recognizing multiple epitopes, making them ideal for detecting low-abundance proteins or for initial characterization studies .

• Monoclonal antibodies offer higher specificity for a single epitope, which can be advantageous for distinguishing between closely related proteins or specific protein conformations.

• Immunogen region is critical - antibodies recognizing different regions of CLCC1 may perform differently depending on protein folding, post-translational modifications, or protein-protein interactions. For example, some CLCC1 antibodies target recombinant fragment proteins within the C-terminus region (aa 400 to C-terminus) , while others target specific peptide sequences like "PPQALRPRDRRRQEEIDYRPDGGAGDADFHYRGQMGPTEQGPYAKTYEGRREILRERDVDLRFQTGNKSPEVLRAFDVPDAEAREHPTVVPSHKSPVLDTKPKE" .

The selection process should include validation of the antibody for the specific application and sample type. Researchers should review available data on epitope specificity, cross-reactivity, and performance in the desired application before making a selection.

What controls should be included when using CLCC1 antibodies?

Proper experimental controls are essential for reliable and interpretable results when using CLCC1 antibodies:

Essential Controls for CLCC1 Antibody Experiments:

For advanced applications, researchers should consider including CLCC1 knockdown/knockout samples as additional specificity controls. This is particularly important when studying CLCC1's role in ER homeostasis mechanisms, where distinguishing specific from non-specific effects is crucial for accurate interpretation .

How can researchers optimize CLCC1 antibody-based immunoprecipitation for studying protein-protein interactions?

Optimizing CLCC1 antibody-based immunoprecipitation requires systematic refinement of several parameters:

Optimization Strategy:

• Antibody Selection: Choose antibodies that recognize epitopes unlikely to be masked by protein interactions. For CLCC1, antibodies targeting the C-terminal region (aa 400 to C-terminus) may be particularly suitable for IP applications .

• Lysis Conditions: Since CLCC1 is an ER membrane protein, use lysis buffers that effectively solubilize membrane proteins while preserving protein-protein interactions:

  • RIPA buffer with reduced detergent concentrations (0.1-0.5% NP-40 or Triton X-100)

  • Addition of calcium chelators (1-2 mM EGTA) to preserve calcium-dependent interactions

  • Protease and phosphatase inhibitor cocktails to prevent degradation

• Binding Conditions:

  • Optimize antibody concentration (typically 2-5 μg per mg of protein lysate)

  • Adjust incubation time (4-16 hours) and temperature (4°C is standard)

  • Consider cross-linking antibodies to beads to prevent antibody contamination in eluates

• Washing Stringency:

  • Implement graduated washing steps with decreasing salt concentrations

  • Include low concentrations of non-ionic detergents to reduce non-specific binding

• Elution Strategy:

  • For native elution, use competing peptides specific to the antibody epitope

  • For denaturing elution, use SDS sample buffer at 95°C for 5 minutes

This methodological approach allows researchers to effectively isolate CLCC1 protein complexes for subsequent analysis using mass spectrometry or western blotting to identify novel interacting partners related to ER homeostasis and the unfolded protein response .

What are the critical considerations when using CLCC1 antibodies for studying ER calcium homeostasis mechanisms?

Studying CLCC1's role in ER calcium homeostasis requires careful experimental design:

Critical Considerations:

• Temporal Dynamics: CLCC1 mediates chloride efflux in response to calcium release from the ER . Design experiments that can capture this temporal relationship:

  • Use calcium imaging techniques (Fura-2, GCaMP) in conjunction with CLCC1 immunofluorescence

  • Implement time-course experiments with synchronized calcium release using thapsigargin or ionomycin

• Spatial Resolution: CLCC1 localization within the ER membrane is crucial for its function:

  • Use super-resolution microscopy (STED, STORM) with CLCC1 antibodies for precise localization

  • Combine with ER markers (calnexin, calreticulin) for co-localization studies

  • Consider proximity ligation assays to detect CLCC1 interactions with calcium channels

• Functional Analysis: Correlate CLCC1 expression/localization with functional readouts:

  • Measure chloride flux using chloride-sensitive fluorescent indicators

  • Monitor ER calcium levels using targeted calcium indicators

  • Assess UPR activation markers (BiP, XBP1 splicing, PERK phosphorylation)

• Specificity Controls: Implement CLCC1 knockdown/overexpression controls to establish causality between CLCC1 activity and observed calcium homeostasis effects.

This multi-faceted approach enables researchers to establish the mechanistic link between CLCC1 function and ER calcium homeostasis, particularly in sensitive cell types like motor neurons and retinal photoreceptors where CLCC1 plays a critical role in survival .

How does CLCC1 antibody epitope selection impact experimental outcomes in different applications?

The selection of antibody epitope can significantly influence experimental outcomes when studying CLCC1:

Epitope-Dependent Effects:

• Structural Constraints: CLCC1 is an ER membrane protein with multiple transmembrane domains. Antibodies targeting different regions may yield varying results:

  • Antibodies recognizing extraluminal domains (cytoplasmic) are typically more accessible in immunocytochemistry applications

  • Antibodies targeting intraluminal domains may require additional permeabilization steps

  • C-terminal directed antibodies (aa 400 to C-terminus) may perform differently than those targeting other regions

• Functional Domain Accessibility: CLCC1's ion selectivity and gating functions may be associated with specific domains:

  • Antibodies binding near functional domains might interfere with channel activity

  • Epitopes near protein-protein interaction sites may be masked in native complexes

  • Conformational epitopes may be lost in denatured samples (Western blot) but preserved in native applications (IP)

• Post-translational Modifications: Different regions of CLCC1 may undergo modifications:

  • Phosphorylation sites might affect antibody binding

  • Glycosylation patterns could mask epitopes in native protein

This understanding should guide antibody selection based on the specific research question. For functional studies of CLCC1's role in chloride efflux, antibodies targeting regions away from the channel pore would be preferable to avoid interference with channel function, while studies focused on protein interactions might benefit from antibodies recognizing interaction domains .

What methodological approaches can resolve discrepancies in CLCC1 localization observed with different antibodies?

Resolving discrepancies in CLCC1 localization requires a systematic multi-method approach:

Resolution Strategy:

• Antibody Validation Panel:

  • Compare multiple antibodies targeting different CLCC1 epitopes

  • Include antibodies raised in different host species for co-localization studies

  • Validate each antibody using CLCC1 knockdown/knockout controls

• Orthogonal Detection Methods:

  • Complement antibody-based detection with tagged CLCC1 constructs (GFP, FLAG)

  • Use fluorescence in situ hybridization (FISH) to correlate protein localization with mRNA distribution

  • Implement subcellular fractionation followed by Western blotting as a biochemical validation

• Advanced Imaging Techniques:

  • Apply super-resolution microscopy to overcome diffraction limits

  • Use live-cell imaging with tagged constructs to eliminate fixation artifacts

  • Implement correlative light and electron microscopy (CLEM) for ultrastructural context

• Quantitative Co-localization Analysis:

  • Use rigorous statistical measures (Pearson's coefficient, Manders' overlap)

  • Implement computational image analysis to eliminate confirmation bias

  • Conduct distance measurements between CLCC1 and known ER markers

• Functional Correlation:

  • Correlate localization data with CLCC1's role in chloride efflux and calcium homeostasis

  • Test if different localization patterns correlate with different functional states of the cell

This comprehensive approach allows researchers to distinguish between true biological variations in CLCC1 localization (which may be cell-type or condition-dependent) and technical artifacts arising from differences in antibody characteristics or experimental procedures .

How can single B-cell screening technologies improve the development of next-generation CLCC1 antibodies?

Single B-cell screening offers significant advantages for developing highly specific CLCC1 antibodies:

Methodological Advantages:

• Accelerated Discovery Timeline: Single B-cell receptor (BCR) cloning can rapidly produce antigen-specific monoclonal antibodies within weeks, compared to traditional methods that may take months .

• Natural Pairing Preservation: Unlike phage display libraries that randomly pair heavy (VH) and light chains (VL), single B-cell screening maintains the natural pairing that occurred during B-cell maturation, resulting in antibodies with higher affinity and specificity :

  • Preserves antibodies selected through in vivo affinity maturation

  • Maintains physiologically relevant antibody characteristics

• Screening Protocol for CLCC1-Specific Antibodies:

  • Immunize models with recombinant CLCC1 protein or specific domains

  • Isolate B cells using fluorescence-activated cell sorting (FACS) with labeled CLCC1 antigen

  • Perform single-cell sorting of antigen-specific B cells

  • Conduct single-cell RT-PCR to amplify paired VH and VL genes

  • Clone and express recombinant antibodies for screening

• Selection Strategy:

  • Screen for antibodies recognizing native CLCC1 conformation in ER membranes

  • Select for epitopes that don't interfere with CLCC1 function

  • Prioritize antibodies that work across multiple applications (IF, WB, IP)

This approach results in antibodies with superior specificity profiles that accurately reflect the immune response to CLCC1, enabling more precise investigation of its role in ER homeostasis mechanisms .

What computational approaches can be used to predict and design CLCC1 antibody specificity?

Modern computational methods offer powerful tools for predicting and designing CLCC1 antibody specificity:

Computational Approaches:

• Epitope Prediction:

  • Implement structure-based algorithms to identify surface-exposed regions of CLCC1

  • Use machine learning models trained on antibody-antigen complexes to predict epitope accessibility

  • Apply sequence conservation analysis to identify unique vs. conserved regions for specificity control

• Paratope Design:

  • Utilize deep learning models to generate antibody sequences with customized specificity profiles

  • Implement computational docking simulations to predict antibody-CLCC1 binding modes

  • Design complementarity-determining regions (CDRs) that maximize interaction with target epitopes

• Cross-Reactivity Analysis:

  • Compare predicted epitopes against proteome databases to identify potential cross-reactive targets

  • Model structural similarities between CLCC1 and related proteins (other chloride channels)

  • Use in silico alanine scanning to identify critical binding residues

• Experimental Validation Pipeline:

  • Design experimental validation schemes based on computational predictions

  • Implement high-throughput assays to test computational predictions

  • Develop feedback loops where experimental data refines computational models

These computational approaches can significantly reduce the experimental burden by narrowing the search space for high-specificity antibodies. The integration of computational design with single B-cell screening represents a powerful paradigm for developing next-generation CLCC1 antibodies with precisely engineered specificity profiles .

How can researchers systematically troubleshoot non-specific binding when using CLCC1 antibodies?

Systematic troubleshooting of non-specific binding requires a methodical approach:

Troubleshooting Framework:

• Antibody-Specific Factors:

  • Titrate antibody concentration to identify optimal signal-to-noise ratio

  • Test different lots of the same antibody to identify lot-to-lot variations

  • Compare polyclonal vs. monoclonal antibodies for the same epitope

  • Verify antibody quality through protein array or peptide epitope mapping

• Sample Preparation Optimization:

  • Test different fixation methods (4% PFA, methanol, acetone) for impact on epitope accessibility

  • Optimize permeabilization conditions (detergent type and concentration)

  • Implement antigen retrieval methods for FFPE samples (citrate buffer, EDTA, enzymatic)

  • Reduce autofluorescence through quenching agents or spectral unmixing

• Blocking Protocol Refinement:

  • Compare different blocking agents (BSA, normal serum, commercial blockers)

  • Extend blocking time to reduce non-specific binding

  • Include additives like 0.1-0.3% Triton X-100, 0.05% Tween-20, or 0.1% gelatin

  • Pre-absorb antibodies with cell/tissue lysates from negative control samples

• Systematic Controls:

  • Implement peptide competition assays using the immunizing peptide

  • Include isotype controls at matching concentrations

  • Use CLCC1 knockdown/knockout samples as gold-standard controls

  • Perform secondary-only controls to assess non-specific secondary binding

• Detection System Optimization:

  • Compare direct vs. indirect detection methods

  • Test signal amplification systems (tyramide, polymer-based)

  • Evaluate different detection modalities (colorimetric vs. fluorescent)

This systematic approach allows researchers to isolate and address specific causes of non-specific binding, ultimately improving the signal-to-noise ratio and reliability of CLCC1 antibody-based experiments .

What are the best practices for validating CLCC1 antibody specificity in different experimental contexts?

Comprehensive validation of CLCC1 antibody specificity requires context-specific approaches:

Validation Best Practices by Application:

• Western Blotting Validation:

  • Verify band size matches predicted CLCC1 molecular weight (~62 kDa)

  • Compare multiple antibodies targeting different CLCC1 epitopes

  • Include positive controls (recombinant CLCC1 protein)

  • Test CLCC1 knockdown/knockout samples for band disappearance

  • Perform peptide competition assays

• Immunohistochemistry/Immunofluorescence Validation:

  • Confirm staining pattern matches known CLCC1 localization (ER membrane)

  • Compare staining patterns with multiple antibodies

  • Correlate protein staining with mRNA expression (RNAscope/FISH)

  • Include absorption controls with immunizing peptide

  • Validate in tissues known to express CLCC1 (e.g., motor neurons, retinal cells)

• Immunoprecipitation Validation:

  • Confirm pulled-down protein by mass spectrometry

  • Verify co-immunoprecipitation of known CLCC1 interacting partners

  • Perform reciprocal IP with antibodies against interacting proteins

  • Include IgG controls to assess non-specific binding to beads/protein A/G

• Flow Cytometry Validation:

  • Compare staining profiles between positive and negative cell populations

  • Correlate surface staining with total CLCC1 expression

  • Implement Fluorescence Minus One (FMO) controls

  • Validate with cells overexpressing or lacking CLCC1

• Cross-Method Validation:

  • Correlate results across different applications

  • Implement orthogonal detection methods

  • Benchmark against established CLCC1 antibodies

This comprehensive validation strategy ensures that experimental findings reflect true CLCC1 biology rather than artifacts of antibody cross-reactivity or non-specific binding .

How might future research directions expand the utility of CLCC1 antibodies beyond current applications?

Future research directions for CLCC1 antibodies hold promise for expanding their utility in both basic and translational research:

Emerging Research Directions:

• Therapeutic Applications: Similar to antibodies targeting claudin-1 for fibrosis , CLCC1-targeting antibodies could potentially modulate ER stress responses in diseases where CLCC1 dysfunction contributes to pathology, particularly in neurological conditions where CLCC1 supports motor neuron survival .

• Conformation-Specific Antibodies: Development of antibodies that recognize specific functional states of CLCC1 (open vs. closed channel conformations) would enable real-time monitoring of channel activity in live cells.

• Proximity-Based Applications: Adaptation of CLCC1 antibodies for proximity labeling approaches (BioID, APEX) could map the dynamic CLCC1 interactome in different cellular contexts, providing insights into its broader role in ER physiology.

• Single-Cell Analysis: Integration of CLCC1 antibodies into single-cell proteomics workflows could reveal cell-type-specific variations in CLCC1 expression and localization, particularly in heterogeneous tissues like the nervous system.

• In Vivo Imaging: Development of near-infrared labeled CLCC1 antibodies or antibody fragments for in vivo imaging could enable monitoring of CLCC1 expression in disease models non-invasively.