CHCHD1 Antibody

What is the molecular function of CHCHD1 in cellular metabolism?

CHCHD1, also known as MRPS37, is a critical component of the small subunit (28S) of the mitochondrial ribosome. Research has demonstrated that CHCHD1 plays an essential role in mitochondrial protein synthesis, particularly in the translation of proteins encoded by mitochondrial DNA that form essential subunits of oxidative phosphorylation (OXPHOS) complexes .

Studies using siRNA knockdown have shown that reducing CHCHD1 expression decreases mitochondrial protein synthesis by approximately 27% without affecting mitochondrial mRNA or rRNA levels . This confirms its direct role in the translation process rather than in transcription or RNA processing. The full-length bovine CHCHD1 is approximately 13.6 kDa, and it has been identified predominantly in the small subunit of mitochondrial ribosomes through mass spectrometry analysis .

How does CHCHD1 differ from other CHCHD family proteins?

While CHCHD1 and other family members like CHCHD10 and CHCHD2 all localize to mitochondria, they have distinct functions:

• CHCHD1 (MRPS37) is primarily associated with the mitochondrial ribosome and protein synthesis as a component of the small subunit .

• CHCHD10 and CHCHD2 form a protein complex that regulates mitochondrial morphology, cristae structure, and maintenance of mitochondrial DNA integrity .

• Mutations in CHCHD10 have been linked to neurodegenerative diseases including amyotrophic lateral sclerosis (ALS), frontotemporal dementia (FTD), and spinal muscular atrophy Jokela-type .

• CHCHD2 and CHCHD10 also play roles in regulating the mitochondrial integrated stress response (mtISR) .

The mammalian mitochondrial CHCHD1 has a homolog in yeast mitochondrial ribosome (MRP10) with approximately 20% sequence identity to the human protein .

What validation criteria should researchers apply when selecting CHCHD1 antibodies?

The gold standard for antibody validation involves comparing signals between wild-type and knockout cell lines. A standardized protocol for CHCHD1 antibody validation includes:

• Using parental and CHCHD1 knockout cell lines (such as HAP1 cells) for side-by-side comparison .

• Testing across multiple applications (Western blot, immunofluorescence, immunoprecipitation).

• Assessing specificity through the mosaic approach for immunofluorescence, where wild-type and knockout cells are plated together in the same well .

• Confirming the expected molecular weight (approximately 13 kDa) in Western blot applications .

• Verifying subcellular localization pattern in immunofluorescence (mitochondrial) .

A comprehensive antibody validation study found that more than 50% of commercial antibodies failed in one or more applications, highlighting the importance of thorough validation .

How do different types of CHCHD1 antibodies compare in performance?

Research on antibody validation has demonstrated that recombinant antibodies generally outperform monoclonal and polyclonal antibodies for most applications . For CHCHD1 specifically:

When selecting antibodies, researchers should consider the validation data available, application requirements, and the need for reproducibility in long-term projects .

What are the optimal protocols for Western blot detection of CHCHD1?

For effective Western blot detection of CHCHD1 (a 13 kDa protein):

• Use high percentage (15-20%) gels to properly resolve this low molecular weight protein.

• Recommended dilutions vary by product but typically range from 1:500-1:1000 .

• Include positive control lysates from cells known to express CHCHD1 (A431 cells are commonly used) .

• For studying mitochondrial ribosomes, include other ribosomal protein markers like MRPS29 (small subunit) or MRPL47 (large subunit) as controls .

• Expected band size is 13 kDa .

• Consider enriching mitochondrial fractions for enhanced detection in cells with lower expression levels.

A typical protocol involves resolving cell lysates on SDS-PAGE, transferring to membranes, blocking (typically with 5% BSA or milk), and probing with anti-CHCHD1 antibodies followed by appropriate secondary antibodies .

How can immunofluorescence protocols be optimized for CHCHD1 detection?

For optimal immunofluorescence detection of CHCHD1:

• Fix cells with 4% paraformaldehyde for 15-20 minutes at room temperature.

• Use gentle permeabilization (0.1-0.2% Triton X-100) to preserve mitochondrial structures.

• Block thoroughly (5% BSA or normal serum) to reduce background.

• Use CHCHD1 antibodies at dilutions ranging from 1:50-1:500, with 1:100 as a common starting point .

• Co-stain with established mitochondrial markers to confirm mitochondrial localization.

• Counterstain with DAPI to visualize nuclei .

For example, paraformaldehyde-fixed A431 cells have been successfully stained with anti-CHCHD1 antibody [EPR12253(2)] at 1/100 dilution followed by goat anti-rabbit IgG (Dylight 488) at 1/200 .

How can CHCHD1 antibodies be used to study mitochondrial translation defects?

CHCHD1 antibodies can be powerful tools for investigating mitochondrial translation:

• Perform siRNA knockdown of CHCHD1 followed by metabolic labeling with [35S]-methionine in the presence of cytosolic protein synthesis inhibitors (like emetine) to directly measure effects on mitochondrial protein synthesis .

• Use immunoprecipitation to isolate CHCHD1-containing complexes and analyze co-precipitating proteins to assess mitochondrial ribosome composition .

• Apply sucrose gradient fractionation to separate ribosomal subunits (28S, 39S, and 55S) and analyze the distribution of CHCHD1 and other ribosomal proteins across fractions .

• Combine immunofluorescence with other mitochondrial markers to assess potential changes in mitochondrial morphology or distribution in disease models.

• Quantify CHCHD1 levels by Western blot and correlate with expression of mitochondrially encoded proteins like COII .

Research has shown that CHCHD1 knockdown results in decreased synthesis of mitochondrially encoded proteins and reduced steady-state levels of COII, while nuclear-encoded OXPHOS subunits remain unchanged .

What methodological approaches can resolve contradictory results with different CHCHD1 antibodies?

When facing contradictory results with different CHCHD1 antibodies:

• Validate all antibodies using knockout controls to determine specificity .

• Map the epitopes recognized by each antibody—for example, some CHCHD1 antibodies target the N-terminal region (e.g., immunogen sequence: MATPSLRGRLARFGNPRKPVLKPNKPLILANRVGERRREKGEATCITEMSVMMACWKQN) .

• Use multiple detection methods (Western blot, immunofluorescence, immunoprecipitation) to cross-validate findings.

• Consider whether different antibodies might recognize distinct conformational states of CHCHD1.

• Implement the mosaic approach for immunofluorescence where wild-type and knockout cells are imaged in the same field to reduce staining and imaging bias .

• Use alternative approaches like epitope-tagged CHCHD1 constructs to validate key findings.

Standardized validation protocols have shown that even when multiple antibodies target the same protein, their performance can vary significantly across applications .

How can researchers differentiate between specific and non-specific signals when using CHCHD1 antibodies?

To distinguish between specific and non-specific signals:

• Always include appropriate controls:

  • Positive control: Cell lines known to express CHCHD1 (e.g., A431, HCT116)

  • Negative control: CHCHD1 knockout cells or siRNA knockdown cells

  • Isotype control: Relevant IgG at the same concentration for immunoprecipitation experiments

• For Western blot:

  • Verify the observed molecular weight matches the expected 13 kDa

  • Test multiple antibodies targeting different epitopes

  • Include a loading control for mitochondrial proteins (e.g., HSP60)

• For immunofluorescence:

  • Confirm mitochondrial localization through co-staining with established markers

  • Use the mosaic approach with knockout cells for direct comparison

  • Include secondary-only controls to check for non-specific binding

• For immunoprecipitation:

  • Analyze both the immunoprecipitate and the depleted supernatant

  • Include IgG control immunoprecipitations

  • Validate interacting partners through reciprocal immunoprecipitation

What are effective strategies for optimizing CHCHD1 antibody-based assays in different tissue types?

Different tissues may require specific optimization strategies:

• For immunohistochemistry:

  • Optimize antigen retrieval methods (e.g., TE buffer pH 9.0 has been recommended for some CHCHD1 antibodies)

  • Test a range of antibody dilutions (typically 1:50-1:500)

  • Include tissue-specific positive and negative controls

• For protein extraction from tissues:

  • Modify lysis buffers to account for tissue-specific characteristics

  • Consider enriching for mitochondrial fractions to enhance detection

  • Use protease inhibitor cocktails to prevent degradation

• For challenging tissues:

  • Consider using freshly prepared samples rather than archived materials

  • Test multiple fixation protocols for immunohistochemistry

  • Optimize permeabilization conditions while preserving tissue architecture

• For species cross-reactivity:

  • Verify sequence homology between species (e.g., mouse and rat CHCHD1 show approximately 92% sequence identity to human)

  • Validate antibody performance in the specific species of interest

  • Consider using species-specific positive controls