chodl Antibody

Shipped with Ice Packs
In Stock

Description

Introduction to CHODL Antibody

The CHODL antibody targets chondrolectin (CHODL), a protein encoded by the CHODL gene located on chromosome 21 (NC_000021.9) . CHODL is emerging as a prognostic biomarker in oncology, with studies suggesting its role in cancer progression and potential as a therapeutic target . This article synthesizes findings on CHODL antibody characterization, production, and clinical relevance, drawing from diverse sources.

Antibody Structure and Function

Antibodies are Y-shaped immunoglobulins composed of two identical heavy chains (~50 kDa) and two light chains (~25 kDa) . Their structure includes:

  • Fab (antigen-binding fragment): Contains variable regions (VH and VL) with hypervariable loops (CDRs) that mediate antigen recognition .

  • Fc (crystallizable fragment): Engages immune effector cells via Fc receptors .

Key Features of CHODL Antibodies

  • Target specificity: CHODL antibodies are designed to bind the CHODL protein, which is overexpressed in certain cancer types .

  • Therapeutic potential: Neutralization of CHODL may inhibit tumor growth, as its expression correlates with aggressive cancer phenotypes .

Challenges in Antibody Development

Antibody production faces challenges in specificity and scalability:

ChallengeSolution
Antigen variabilityRecombinant technologies (e.g., phage display) to enhance CHODL-specific binding .
Cross-reactivityUse of knockout (KO) cell lines for validation, as demonstrated by the YCharOS study .
Production efficiencyCHO cells with dual selectable markers (e.g., MTX/MSX) for high-yield manufacturing .

CHO Cell Lines

CHO cells are the gold standard for monoclonal antibody production. A "double selection" approach using MTX and MSX markers achieves higher productivity .

Deep Learning-Driven Design

Models like AbDiffuser and DiffAb enable sequence-structure co-design of CHODL-binding antibodies. These methods leverage structural data (e.g., SAbDab) to optimize CDR regions .

Characterization and Validation

Robust characterization ensures antibody specificity:

AssayApplication
Western BlotDetects CHODL expression in cancer lysates .
ImmunohistochemistryValidates tissue-specific binding (e.g., tumor versus normal tissue) .
KO Cell ControlsConfirms target specificity by comparing wild-type and CHODL-deficient cells .

Clinical Relevance and Future Directions

  • Cancer biomarker: CHODL antibodies may enable early diagnosis and monitoring of cancers with elevated CHODL expression .

  • Therapeutic development: Preclinical studies are exploring CHODL-targeting antibodies for cancer treatment .

Product Specs

Buffer
**Preservative:** 0.03% Proclin 300
**Constituents:** 50% Glycerol, 0.01M PBS, pH 7.4
Form
Liquid
Lead Time
Made-to-order (14-16 weeks)
Synonyms
chodl antibody; zgc:110088 antibody; Chondrolectin antibody
Target Names
chodl
Uniprot No.

Target Background

Function
CHODL plays a crucial role in the development of the nervous system, specifically in neurite outgrowth and elongation. It is involved in motor axon growth and guidance, ensuring proper interactions between motor axons and the horizontal myoseptum.
Gene References Into Functions
  1. Research findings identify upstream regulators and downstream functions of CHODL during motor axon growth. PMID: 22457492
Database Links
Subcellular Location
Membrane; Single-pass type I membrane protein.
Tissue Specificity
Expressed in developing motor neurons.

Q&A

What is CHODL and why is it an important research target?

Chondrolectin (CHODL) is a type I transmembrane protein that functions as a C-type lectin. It plays significant roles in muscle and neural development, making it an important target for developmental biology research. CHODL antibodies are crucial tools for detecting this protein in various experimental contexts. The protein is encoded by the CHODL gene and has several alternative splice variants that may exhibit tissue-specific expression patterns. Understanding CHODL's function has implications for studying developmental disorders and neuromuscular diseases, which explains the growing interest in developing specific antibodies targeting this protein .

What are the main applications for CHODL antibodies in research?

CHODL antibodies are primarily used in Western Blotting (WB) and ELISA techniques. These applications allow researchers to detect and quantify CHODL protein expression in various biological samples. Western Blotting is particularly useful for determining protein size (approximately 30 kDa for CHODL) and expression levels in tissue or cell lysates. ELISA techniques provide quantitative measurements of CHODL in solution. Some CHODL antibodies may also be suitable for immunohistochemistry (IHC) and immunocytochemistry (ICC), though these applications depend on the specific antibody preparation and validation .

What species reactivity should I consider when selecting a CHODL antibody?

Different CHODL antibodies exhibit varying reactivity profiles across species. When selecting an antibody, researchers must ensure compatibility with their experimental model. Available CHODL antibodies may react with human, mouse, rat, or multiple species samples. For example, the mouse polyclonal CHODL antibody (ABIN566835) reacts with human samples, while the rabbit polyclonal CHODL antibody (A309252) reacts with both mouse and rat samples. Cross-reactivity testing is essential when using antibodies in species not explicitly listed in the product specifications .

What dilution ranges are recommended for CHODL antibodies in Western blotting?

For Western blotting applications, CHODL antibodies typically require specific dilution ranges for optimal results. The rabbit polyclonal CHODL antibody (A309252) recommends dilutions between 1:500 and 1:2,000 for Western blotting applications. The optimal dilution may vary depending on the sample type, protein abundance, and detection method. It is advisable to perform a dilution series in preliminary experiments to determine the optimal antibody concentration for your specific experimental conditions .

How do different immunogens affect CHODL antibody specificity and performance?

CHODL antibodies are generated using different immunogens representing various regions of the protein, which significantly impacts their specificity and performance. Antibodies raised against amino acids 23-94 (N-terminal region) may recognize different epitopes compared to those targeting amino acids 110-210 (middle region) or C-terminal sequences. The immunogen sequence "RVVSGQKVCF ADFKHPCYKM AYFHELSSRV SFQEARLACE SEGGVLLSLE NEAEQKLIES MLQNLTKPGT GI" produces antibodies with different binding characteristics than those generated using the sequence "YRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICKYEPEINPTAPVEKPYLTNQPGDTHQNVVVTEAGIIPNLIYVVIPTIPLLL". These differences can affect epitope accessibility in native versus denatured conditions, making certain antibodies more suitable for specific applications .

What strategies can address cross-reactivity issues with CHODL antibodies?

Cross-reactivity can significantly complicate CHODL antibody applications. Researchers should implement multiple validation strategies including knockout/knockdown controls, peptide competition assays, and parallel testing with antibodies targeting different epitopes. When cross-reactivity is observed, pre-adsorption techniques can be employed by incubating the antibody with excess purified cross-reactive protein prior to the experiment. Alternatively, more stringent washing conditions or higher dilutions may reduce non-specific binding. Comparing results from multiple antibodies targeting different CHODL epitopes can help distinguish true signals from cross-reactivity artifacts .

How can I validate CHODL antibody specificity for my particular experimental system?

Rigorous validation is essential for ensuring CHODL antibody specificity in your experimental system. A comprehensive validation approach includes: (1) testing in CHODL-knockout or knockdown samples as negative controls; (2) confirming the expected molecular weight (approximately 30 kDa); (3) demonstrating tissue distribution patterns consistent with known CHODL expression; (4) comparing results from multiple antibodies targeting different epitopes; and (5) performing peptide competition assays. For advanced validation, mass spectrometry identification of immunoprecipitated proteins can provide definitive confirmation of antibody specificity .

What sample preparation techniques optimize CHODL detection in Western blotting?

Optimal sample preparation for CHODL detection requires consideration of protein localization and structure. Since CHODL is a transmembrane protein, effective extraction requires appropriate lysis buffers containing detergents like NP-40, Triton X-100, or CHAPS. Cell lysis should be performed at 4°C with protease inhibitors to prevent degradation. For membrane-enriched fractions, sequential extraction methods may improve detection. Sample denaturation conditions should be optimized for CHODL—using moderate temperatures (70°C instead of 95°C) for shorter durations may preserve epitopes better for some antibodies. Running reduced and non-reduced samples in parallel can help identify if disulfide bonds affect epitope recognition .

How should CHODL antibody storage and handling be managed to maintain activity?

Proper storage and handling are critical for maintaining CHODL antibody activity. Upon receipt, antibodies should be aliquoted to avoid repeated freeze-thaw cycles, which can significantly reduce activity. The rabbit polyclonal CHODL antibody (A309252) is shipped at 4°C and should be stored at -20°C after aliquoting. The storage buffer containing 50% glycerol and 0.01% thiomersal helps maintain stability during freezing. Working dilutions should be prepared fresh and used immediately or stored at 4°C for no more than 24 hours. Antibody solutions should never be vortexed vigorously, as this can lead to protein denaturation; instead, gentle inversion or slow pipetting should be used for mixing .

What controls should be included in CHODL antibody experiments?

A robust experimental design for CHODL antibody applications requires several controls. Positive controls should include samples known to express CHODL, such as appropriate cell lines or tissue lysates with confirmed expression. Negative controls should include samples where CHODL expression is absent or knocked down. Loading controls (e.g., housekeeping proteins) are essential for Western blot experiments to ensure equal protein loading across lanes. For immunohistochemistry, isotype controls using non-specific rabbit IgG (for rabbit polyclonal antibodies) help assess background staining. When testing new lots of antibodies, side-by-side comparison with previously validated lots is recommended to ensure consistent performance .

How can inconsistent CHODL antibody results be reconciled across different experimental techniques?

Inconsistencies in CHODL detection across techniques may stem from multiple factors requiring systematic troubleshooting. Different techniques expose different epitopes—Western blotting typically exposes linear epitopes in denatured proteins, while ELISA may detect native conformations. If an antibody works in Western blot but not immunohistochemistry, epitope masking by fixation or protein interactions may be occurring. To reconcile inconsistencies, researchers should: (1) verify antibody integrity; (2) optimize protocols for each technique separately; (3) use multiple antibodies targeting different epitopes; and (4) consider native versus denatured protein states. Quantitative comparisons between techniques should acknowledge their different sensitivities and dynamic ranges .

What factors affect quantitative analysis of CHODL expression using antibody-based methods?

Quantitative analysis of CHODL expression faces several technical challenges that must be addressed methodologically. Signal linearity must be established by running standard curves with known protein concentrations. For Western blotting, the dynamic range is typically 10-fold, and exposures should be optimized to prevent saturation. Normalization strategies are crucial—housekeeping proteins may vary across tissues or experimental conditions, so multiple loading controls should be tested. Image acquisition parameters must remain consistent across experiments, and digital image processing should avoid manipulations that alter signal linearity. Statistical analysis should account for technical replicates (repeated measurements of the same sample) versus biological replicates (different samples from the same experimental group) .

How does experimental design influence statistical analysis of CHODL antibody data?

The experimental design fundamentally shapes appropriate statistical approaches for CHODL antibody data. When comparing different antibody detection techniques applied to the same samples, paired statistical tests are appropriate since sample-to-sample variation can be separated from technique-related variation. For titration experiments with multiple antibodies tested across different techniques, two-way ANOVA can partition variance between these factors. Sample size determination should consider both technical variability (coefficient of variation in replicate measurements) and expected effect size. Non-normal distributions are common in antibody data, particularly with small sample sizes, making nonparametric tests often more appropriate than parametric alternatives. Statistical analysis should avoid treating technical replicates as independent samples, as this artificially inflates sample size and increases the risk of Type I errors .

How do polyclonal and monoclonal CHODL antibodies compare in research applications?

Polyclonal and monoclonal CHODL antibodies offer distinct advantages in different research contexts. The mouse polyclonal antibody (ABIN566835) recognizes multiple epitopes within amino acids 23-94, potentially providing higher sensitivity but with increased risk of cross-reactivity. In contrast, monoclonal antibodies (such as clone 1A5) recognize single epitopes, offering higher specificity but potentially lower sensitivity. Polyclonal antibodies often perform better in applications where protein may be partially denatured or where epitope accessibility varies. Monoclonal antibodies provide greater lot-to-lot consistency and are preferred for long-term studies requiring reproducibility. For critical experiments, validating results with both antibody types provides the most robust confirmation of findings .

What is the significance of different CHODL epitopes for antibody selection?

The epitope targeted by a CHODL antibody significantly impacts its utility in different applications. N-terminal antibodies (AA 23-94) may access different regions than those targeting middle segments (AA 110-210) or C-terminal domains. Post-translational modifications, protein-protein interactions, or conformational changes may mask specific epitopes in certain experimental contexts. The sequence "RVVSGQKVCF ADFKHPCYKM AYFHELSSRV SFQEARLACE SEGGVLLSLE NEAEQKLIES MLQNLTKPGT GI" represents a portion that may be more accessible in certain assays compared to other regions. For comprehensive characterization, using antibodies targeting different epitopes in parallel provides complementary data and greater confidence in results .

The following table summarizes key characteristics of different CHODL antibodies:

Antibody IDHostClonalityTarget RegionReactivityApplicationsRecommended Dilutions
ABIN566835MousePolyclonalAA 23-94HumanWB, ELISANot specified
A309252RabbitPolyclonalAA 110-210Mouse, RatWB1:500-1:2,000
UnnamedRabbitPolyclonalAA 105-206HumanWB, ELISA, IHC, IFNot specified
UnnamedRabbitPolyclonalAA 161-210Multiple speciesWBNot specified
UnnamedRabbitPolyclonalC-TermHuman, MouseWBNot specified
UnnamedRabbitPolyclonalAA 48-214HumanWB, IHC, ICCNot specified

What emerging applications of CHODL antibodies show promise for future research?

Emerging applications for CHODL antibodies extend beyond traditional protein detection methods. Techniques combining CHODL antibodies with proximity ligation assays offer increased sensitivity and the ability to detect protein-protein interactions in situ. Advanced imaging approaches using fluorescently-labeled CHODL antibodies allow for tracking protein localization dynamics in live cells. Therapeutic applications targeting CHODL are being explored in developmental biology and neuroscience research. As these techniques evolve, researchers will need increasingly specific and well-characterized CHODL antibodies optimized for these novel applications. The continued development of monoclonal antibodies with defined epitope specificity will be particularly valuable for reproducible research outcomes in these emerging fields .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.