CMBL Antibody
Shipped with Ice Packs 
In Stock 
Description
Functional Roles of CMBL
CMBL mediates the bioactivation of prodrugs through ester bond hydrolysis:
| Prodrug | Active Metabolite | Therapeutic Class |
|---|---|---|
| Olmesartan medoxomil | Olmesartan | Angiotensin receptor blocker |
| Faropenem medoxomil | Faropenem | β-lactam antibiotic |
| Lenampicillin | Ampicillin | Penicillin antibiotic |
Key functional attributes:
-
Tissue distribution: Highest expression in liver cytosol, followed by kidney, small intestine, and colon
CMBL Antibody Development
Two primary antibody types have been characterized:
Monoclonal Antibody (PAT2B11AT)
-
Host: BALB/c mouse
-
Immunogen: Recombinant human CMBL (aa 1-245)
-
Specificity: Recognizes native and denatured CMBL
-
Applications: Western blot, ELISA, immunohistochemistry
Polyclonal Antibody (NBP1-82069)
-
Host: Rabbit
-
Epitope: AYPCPCDIGHRLEYGGLGREVQVEHIKAYVTKSPVDAGKAVIVIQDIFGWQLPNTRYIADMISGNGYTTIVPDFFVG
-
Cross-reactivity: 88% sequence identity with mouse/rat CMBL homologs
-
Validation: Confirmed in Western blot (0.04-0.4 μg/mL working concentration) and IHC
Research Applications of CMBL Antibodies
Critical research insights:
Product Specs
Buffer
PBS with 0.1% Sodium Azide, 50% Glycerol, pH 7.3. Store at -20°C. Avoid freeze-thaw cycles.
Lead Time
Typically, we can ship your order within 1-3 business days of receiving it. Delivery times may vary depending on the purchase method or location. Please consult your local distributor for specific delivery times.
Synonyms
Carboxymethylenebutenolidase homolog (Pseudomonas) antibody; Carboxymethylenebutenolidase homolog antibody; cmbl antibody; CMBL_HUMAN antibody; FLJ23617 antibody
Target Names
CMBL
Uniprot No.
Target Background
Function
CMBL is a cysteine hydrolase. It converts the prodrug olmesartan medoxomil into its pharmacologically active metabolite olmesartan, an angiotensin receptor blocker, in the liver and intestine. CMBL may also activate beta-lactam antibiotics faropenem medoxomil and lenampicillin.
Gene References Into Functions
- Through comparative analysis of enzyme kinetics and chemical inhibition properties between recombinant protein and tissue preparations, CMBL was identified as the primary enzyme responsible for olmesartan medoxomil bioactivation in the liver and intestine. PMID: 20177059
Database Links
Protein Families
Dienelactone hydrolase family
Subcellular Location
Cytoplasm, cytosol.
Tissue Specificity
Widely expressed, with highest levels in liver, followed by kidney, small intestine and colon. Present in liver and intestine (at protein level).
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
