rtraf Antibody

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

RTRAF (UniProt ID: Q9Y224) is encoded by the C14orf166 gene and localizes to both nuclear and cytoplasmic compartments . Its functions include:

  • Transcriptional regulation: Modulates RNA polymerase II activity .

  • tRNA splicing: Functions as a component of the tRNA-splicing ligase complex .

  • mRNA translation: Forms part of the cap-binding complex, enhancing translation initiation .

  • Viral interactions: Facilitates influenza virus replication and packaging .

Antibody Applications

RTRAF antibodies are primarily used in molecular biology techniques to study protein expression and localization:

ApplicationDescriptionCommon Antibodies
Western Blot (WB)Detects RTRAF in cell lysates or tissues .Thermo Fisher CF803909, Boster A31823
ImmunohistochemistryVisualizes RTRAF in tissue sections .Abcam EPR15799, Abbexa Rabbit Polyclonal
ImmunoprecipitationIsolates RTRAF and associated proteins for downstream analysis .Bio-Techne CoraFluor™ 1
ELISAQuantifies RTRAF levels in biological samples .Abbexa Rabbit Polyclonal

Research Findings

a. RNA Metabolism:
RTRAF interacts with the 7SK snRNA complex, influencing RNA polymerase II transcription . It also binds the 5' cap structure of mRNAs, promoting translation initiation .

b. Viral Pathogenesis:
RTRAF is hijacked by influenza virus to enhance replication and viral particle assembly .

c. Cellular Stress:
Under stress conditions, RTRAF relocalizes to stress granules, modulating mRNA storage and degradation .

Citations and References

  1. NCBI Gene Database: RTRAF entry .

  2. Thermo Fisher Scientific: RTRAF Antibody CF803909 .

  3. Biocompare: Anti-RTRAF Antibody Products .

  4. Boster Bio: Anti-C14orf166 RTRAF Antibody A31823 .

  5. Abbexa: Rabbit Polyclonal Antibody .

  6. PMC Article: hCLE/RTRAF-HSPC117-DDX1-FAM98B complex .

Product Specs

Buffer
**Preservative:** 0.03% Proclin 300
**Constituents:** 50% Glycerol, 0.01M PBS, pH 7.4
Form
Liquid
Lead Time
Made-to-order (14-16 weeks)
Synonyms
rtraf antibody; zgc:56576 antibody; RNA transcription antibody; translation and transport factor protein antibody
Target Names
rtraf
Uniprot No.

Target Background

Function
RNA-binding protein involved in modulation of mRNA transcription by Polymerase II. Component of the tRNA-splicing ligase complex.
Database Links
Protein Families
RTRAF family
Subcellular Location
Nucleus. Cytoplasm, cytosol. Cytoplasm, perinuclear region. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome.

Q&A

What is RTRAF and why is it important in cellular RNA processing research?

RTRAF (RNA transcription, translation and transport factor), also known as C14orf166, is a 28.1 kDa RNA-binding protein with both nuclear and cytoplasmic localization. It plays critical roles in multiple RNA metabolism pathways and is widely expressed across many tissue types .

RTRAF serves as a key component in several important complexes:

  • The human spliceosome complex

  • The 7SK snRNA methylphosphate capping complex

  • The tRNA-splicing ligase complex (essential for tRNA ligation)

Research significance: RTRAF's involvement in transcription, translation, and RNA transport makes it a valuable target for studying fundamental RNA processing mechanisms. Its proper detection using antibodies provides insights into RNA metabolism regulation in normal cellular function and disease states.

What are the optimal applications for RTRAF antibody detection in cellular studies?

RTRAF antibodies have been validated for multiple applications with varying optimization parameters:

ApplicationTypical Dilution RangeCommon Detection MethodsSample Types
Western Blot (WB)1:500-1:2000 Chemiluminescence, FluorescenceCell lysates, tissue extracts
Immunohistochemistry (IHC)1:50-1:200 DAB, AECParaffin sections, frozen sections
Immunocytochemistry (ICC)Varies by antibodyFluorescenceFixed cells
Immunofluorescence (IF)Varies by antibodyFluorescence microscopyFixed cells, tissues
ELISA1 μg/ml Colorimetric, FluorescentPurified protein, cell lysates

Methodological considerations:

  • For Western blot applications, RTRAF typically appears at 25-28 kDa , though hCLE trimers may be observed at higher molecular weights

  • Cross-reactivity between species should be verified based on homology to the immunogen sequence (human RTRAF shows 92% homology with mouse)

  • Proper validation should include positive controls with known RTRAF expression (e.g., Jurkat cells)

How do different RTRAF antibody clones compare in terms of epitope recognition and specificity?

Different antibodies target distinct regions of RTRAF, affecting their application performance and cross-reactivity profiles:

Target RegionExample ProductImmunogen InformationSpecies ReactivityNotes
N-terminalARP34545_P050 Synthetic peptide from region: GLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGVHuman, Mouse, Rat, multiple others92% sequence homology with mouse
Middle regionReferenced in multiple sourcesVarious mid-region peptidesHuman, Mouse, multi-speciesOften provides broader species cross-reactivity
C-terminalReferenced in search resultsC-terminal region peptidesHuman, Mouse, multi-speciesMay detect specific isoforms
Full-lengthMultiple productsRecombinant fusion protein containing amino acids 1-244 of human RTRAF Human, MouseRecognizes multiple epitopes

When selecting an antibody clone, researchers should consider:

  • The specific protein domain requiring investigation

  • Required species cross-reactivity based on experimental models

  • Whether post-translational modifications might affect epitope recognition

  • Whether complex formation with RTRAF partners (DDX1, HSPC117, FAM98B) might mask epitopes

What validation steps should be performed before using RTRAF antibodies in critical experiments?

Thorough validation ensures reliable results in RTRAF research:

  • Positive control testing: Verify antibody reactivity using cell lines with established RTRAF expression (e.g., Jurkat cells)

  • Knockout/knockdown validation: Compare detection in wildtype vs. RTRAF-depleted samples to confirm specificity

  • Cross-reactivity assessment: If working across species, verify reactivity based on immunogen sequence homology (e.g., human RTRAF shows 92% homology with mouse, 85% with rat)

  • Blocking peptide controls: For critical applications, use specific blocking peptides to confirm binding specificity:

    • Example: For anti-RTRAF (ARP34545_P050), blocking peptide catalog # AAP34545 can be used

  • Multiple application testing: Verify consistency across different detection methods (WB, IHC, ICC)

  • Lot-to-lot consistency evaluation: Test new antibody lots against previously validated lots

What are the best sample preparation methods for detecting RTRAF in different cellular compartments?

RTRAF exhibits both nuclear and cytoplasmic localization, requiring specialized preparation methods:

For Western Blot detection:

  • Total protein extraction: Standard RIPA or NP-40 buffers with protease inhibitors

  • Nuclear/cytoplasmic fractionation: Use specialized kits to separate compartments before antibody probing

  • Recommended buffer: PBS with protease inhibitors for initial extraction

For Immunohistochemistry/Immunocytochemistry:

  • Fixation: 4% paraformaldehyde is typically effective for RTRAF preservation

  • Permeabilization: 0.1-0.5% Triton X-100 to allow antibody access to nuclear RTRAF

  • Antigen retrieval: May be required for paraffin sections (citrate or EDTA buffer at pH 6.0)

For complex detection (RTRAF with binding partners):

  • Gentler extraction buffers that preserve protein-protein interactions

  • Consider chemical crosslinking to stabilize complexes before extraction

  • Co-immunoprecipitation conditions may need optimization to maintain RTRAF complexes with DDX1, HSPC117, and FAM98B

How does RTRAF's involvement in cap-binding complexes impact translation research methodologies?

RTRAF (hCLE/C14orf166) forms a complex with DDX1, HSPC117, and FAM98B that exhibits cap-binding activity and modulates mRNA translation . This has significant methodological implications:

Key research findings:

  • hCLE complex has demonstrable cap-binding activity and positively regulates mRNA translation

  • The complex binds to m7GTP resins in a similar manner to the cellular cap-binding factor eIF4E

  • Components include hCLE monomers and trimers along with DDX1, HSPC117, and FAM98B

Methodological approaches:

  • Cap-binding assays: Use m7GTP-coupled resins to isolate RTRAF complexes from cellular extracts

  • Complex quantification: Measure percentage of components bound to m7GTP resins compared to control resins

  • Translation studies: Investigate how RTRAF depletion/overexpression affects cap-dependent translation

Experimental considerations:

  • Control resins without m7GTP are essential to distinguish specific from non-specific binding

  • Total extract application followed by specific elution with m7GTP can confirm specificity

  • The detection of both monomeric and trimeric forms of RTRAF requires appropriate gel separation conditions

What role does RTRAF play in viral infections and how can antibodies help study these interactions?

RTRAF has demonstrated important roles in viral life cycles, particularly for influenza virus:

Documented RTRAF-virus interactions:

  • Interacts with influenza virus polymerase

  • Positively modulates viral multiplication

  • Becomes incorporated into influenza virus particles

Antibody-based experimental approaches:

  • Co-immunoprecipitation studies: Use anti-RTRAF antibodies to pull down viral-host protein complexes

  • Immunofluorescence co-localization: Track RTRAF redistribution during viral infection

  • Proximity ligation assays: Detect direct RTRAF-viral protein interactions in situ

  • Chromatin immunoprecipitation: Examine RTRAF recruitment to viral genomic elements

Methodological considerations:

  • Timing of infection is critical as RTRAF-virus interactions may be dynamic

  • Both native and tagged RTRAF systems may be necessary to validate interactions

  • Antibody selection should account for potential epitope masking during viral protein binding

How can researchers distinguish between different RTRAF protein forms (monomers vs. oligomers)?

RTRAF/hCLE can exist in multiple forms including monomers and trimers , creating challenges for accurate characterization:

Protein form identification methods:

  • Gel electrophoresis conditions:

    • Monomeric RTRAF appears at ~28 kDa

    • Trimeric forms appear at higher molecular weights

    • Use gradient gels (4-15%) for better separation of different forms

  • Mass spectrometry verification:

    • As demonstrated in previous research, MALDI-TOF/TOF analysis can confirm the identity of different RTRAF forms

    • Excise antibody-reactive bands from silver-stained gels for analysis

  • Crosslinking studies:

    • Chemical crosslinkers can stabilize oligomeric forms prior to analysis

    • Compare crosslinked and non-crosslinked samples to identify natural oligomers

  • Size-exclusion chromatography:

    • Separate different RTRAF complexes based on molecular size

    • Follow with western blot analysis using anti-RTRAF antibodies

Technical considerations:

  • Sample preparation conditions can affect oligomerization state

  • Detergent selection and concentration may impact complex stability

  • Temperature during sample handling may influence monomer-trimer equilibrium

What are the emerging specialized applications of RTRAF antibodies in RNA biology research?

Recent advances have expanded the utility of RTRAF antibodies beyond traditional applications:

RNA-protein interaction studies:

  • CLIP (Cross-linking and immunoprecipitation) using RTRAF antibodies to identify bound RNA targets

  • RIP-seq (RNA immunoprecipitation sequencing) to map RTRAF binding across the transcriptome

  • Proximity RNA labeling to identify RNAs near RTRAF complexes

Translation regulation research:

  • Polysome profiling combined with RTRAF immunoprecipitation

  • Cap-binding complex isolation using cap analogs followed by RTRAF immunoblotting

  • Ribosome profiling in RTRAF-depleted vs. control cells

Cell cycle-dependent functions:

  • Synchronization studies to examine RTRAF localization throughout cell cycle phases

  • ChIP-seq to identify potential chromatin-association of RTRAF during different cell states

  • Phospho-specific antibodies to detect post-translational modifications of RTRAF

Technical recommendations:

  • For RNA-centric applications, RNase inhibitors are essential during sample preparation

  • For nuclear applications, specialized nuclear extraction protocols optimize yield

  • For interactions with other proteins, gentle lysis conditions help preserve complexes

How can researchers troubleshoot common issues with RTRAF antibody applications?

When working with RTRAF antibodies, several technical challenges may arise:

Problem: Poor signal in Western blot
Possible solutions:

  • Optimize antibody concentration (recommended range: 1:500-1:2000)

  • Increase protein loading (RTRAF may be low abundance in some tissues)

  • Extend primary antibody incubation (overnight at 4°C)

  • Try alternative extraction buffers to improve protein solubilization

  • Use more sensitive detection systems (ECL-Plus, fluorescent secondaries)

Problem: Non-specific bands
Possible solutions:

  • Increase blocking concentration/time (5% BSA or milk)

  • Perform more stringent washing steps

  • Use blocking peptides as controls to identify specific bands

  • Consider monoclonal antibodies for higher specificity

  • Reduce primary antibody concentration

Problem: Inconsistent immunostaining results
Possible solutions:

  • Optimize fixation protocols (PFA vs. methanol)

  • Test different antigen retrieval methods for IHC

  • Adjust permeabilization conditions to ensure antibody access

  • Include positive control tissues with known RTRAF expression

  • Ensure consistent antibody handling and storage (avoid repeated freeze-thaw)

Problem: Poor co-immunoprecipitation efficiency
Possible solutions:

  • Test different lysis buffers that preserve protein-protein interactions

  • Adjust salt concentration to optimize specific binding

  • Consider crosslinking prior to extraction

  • Use recombinant protein standards to verify pull-down efficiency

  • Test alternative antibody formats (directly conjugated beads)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.