cnpy4 Antibody

What is CNPY4 and what cellular functions does it regulate?

CNPY4 (canopy 4 homolog) is a protein that plays significant roles in both immune regulation and developmental pathways. Research indicates that CNPY4 functions as an inhibitor of the Hedgehog (HH) signaling pathway by modulating membrane sterols . It has a calculated molecular weight of 28 kDa and consists of 248 amino acids . CNPY4 has been identified as a potential biomarker in gliomas, where its expression correlates with immune cell infiltration patterns . The protein appears to have immunoregulatory functions, particularly affecting interactions between lymphoid and nonlymphoid cells and influencing multiple immune-related pathways including those involved in cancer immunotherapy .

What applications are suitable for CNPY4 antibodies in research?

CNPY4 antibodies have demonstrated effectiveness in several research applications:

Each application requires specific optimization depending on the experimental system and sample type . For Western blotting, the observed molecular weight is consistently reported at 28 kDa across multiple antibody manufacturers, which can serve as a validation point for specificity .

What are the recommended storage conditions for CNPY4 antibodies?

Most commercially available CNPY4 antibodies require similar storage conditions for optimal stability and performance:

• Storage temperature: -20°C for long-term storage

• Buffer composition: Typically supplied in PBS with 0.02% sodium azide and 40-50% glycerol at pH 7.3-7.5

• Stability: Generally stable for one year after shipment when stored properly

• Aliquoting: While some manufacturers indicate aliquoting is unnecessary for -20°C storage, dividing into single-use aliquots is recommended to avoid repeated freeze-thaw cycles which can degrade antibody performance

• Working solutions: Can be stored at 4°C for short-term use (typically 1-2 weeks)

These storage recommendations ensure antibody stability and consistent performance across experiments, which is crucial for reproducible research outcomes.

How should CNPY4 antibodies be validated before experimental use?

Proper validation of CNPY4 antibodies should follow a multi-step approach:

• Western blot verification: Confirm the detection of a single band at the expected molecular weight of 28 kDa in appropriate positive control samples (e.g., HeLa cells)

• Positive and negative controls: Include tissues or cell lines known to express or lack CNPY4, respectively. This is particularly important for immunohistochemistry applications

• Knockdown/knockout validation: If possible, use CNPY4 siRNA knockdown or knockout samples to confirm antibody specificity, similar to the approach used in studies examining CNPY4 function

• Cross-reactivity testing: Evaluate potential cross-reactivity with other CNPY family members (CNPY1, CNPY2, CNPY3) which share structural similarities

• Dilution optimization: Test multiple antibody dilutions to determine the optimal concentration that provides specific signal with minimal background for each experimental system and application

This systematic validation approach ensures reliable results and minimizes the risk of experimental artifacts or misinterpretation of data.

What is the role of CNPY4 in the Hedgehog signaling pathway and its methodological implications?

CNPY4 functions as an inhibitor of the Hedgehog (HH) signaling pathway by modulating membrane sterol levels. Key findings and methodological considerations include:

• Knockout phenotypes: CNPY4 knockout mouse embryos display polydactyly and other developmental abnormalities consistent with HH pathway overactivation

• Signaling assays: Luciferase reporter assays measuring Gli expression in NIH3T3 cells following CNPY4 knockdown showed elevated basal activation of the HH transcriptional program and potentiated signaling in response to various HH pathway agonists

• Sterol modulation: CNPY4 appears to exert its inhibitory effect on the HH pathway by decreasing levels of sterol lipids at the plasma membrane. This can be measured using protein probes derived from Perfringolysin O (PFO*) coupled to fluorescent tags

• Methodological approach: When studying CNPY4's role in HH signaling, researchers should:

  • Utilize multiple HH pathway agonists (SAG, recombinant SHH, synthetic and cilia-associated oxysterols) to comprehensively assess pathway activation

  • Directly analyze Gli1 expression changes rather than relying solely on reporter assays

  • Complement cell line studies with in vivo models (e.g., knockout mice) to validate findings

  • Include direct measurements of membrane sterol levels using appropriate probes

These approaches provide a comprehensive understanding of how CNPY4 regulates HH signaling and offer insights into potential therapeutic targeting of this pathway in developmental disorders and cancer.

How does CNPY4 expression relate to immune infiltration in gliomas and what techniques are optimal for investigation?

CNPY4 has emerged as a potential biomarker associated with immune infiltration in gliomas. Research findings and methodological considerations include:

• Expression correlation: CNPY4 expression shows significant correlation with immune cell infiltration in both glioblastoma (GBM) and low-grade gliomas (LGG), but with distinct patterns

• Cell type specificity:

  • In GBM: CNPY4 expression positively correlates with dendritic cell infiltration (Partial Cor = 0.28)

  • In LGG: CNPY4 expression positively correlates with infiltration of B cells (Partial Cor = 0.352), CD4+ T cells (Partial Cor = 0.406), macrophages (Partial Cor = 0.417), neutrophils (Partial Cor = 0.351), and dendritic cells (Partial Cor = 0.445)

• Clinical implications: Univariate logistic regression analysis showed that increased CNPY4 expression was associated with tumor age, grade, IDH status, and 1p/19q codeletion. Multivariate analysis demonstrated that downregulation of CNPY4 expression was an independent prognostic factor

• Recommended methodological approaches:

  • CIBERSORT analysis: To determine the relationship between CNPY4 expression and immune cell proportions, comparing high versus low expression groups

  • TIMER analysis: To study the correlation between CNPY4 expression and immune infiltration levels across different cancer types

  • Immunohistochemistry: Using validated CNPY4 antibodies (1:200-1:500 dilution) on patient samples to correlate protein expression with clinical parameters

  • Gene Set Enrichment Analysis (GSEA): To identify immune-related pathways associated with CNPY4 expression

These methods provide complementary insights into how CNPY4 influences the tumor immune microenvironment, potentially identifying new therapeutic targets and prognostic indicators.

What are the optimal conditions for Western blot analysis using CNPY4 antibodies?

Optimizing Western blot protocols for CNPY4 detection requires careful consideration of several parameters:

• Sample preparation:

  • Cell lysis buffer: Standard RIPA buffer with protease inhibitors is generally effective

  • Protein loading: 20-40 μg of total protein per lane is typically sufficient for detection

  • Heat denaturation: 95°C for 5 minutes in Laemmli buffer with β-mercaptoethanol

• Gel electrophoresis and transfer:

  • 10-12% SDS-PAGE gels are appropriate for the 28 kDa CNPY4 protein

  • Semi-dry or wet transfer to PVDF or nitrocellulose membranes (0.2 μm pore size)

  • Transfer conditions: 100V for 60-90 minutes or 25V overnight at 4°C

• Antibody incubation:

  • Blocking: 5% non-fat dry milk or BSA in TBST for 1 hour at room temperature

  • Primary antibody: Dilute CNPY4 antibody 1:500-1:2000 in blocking buffer

  • Incubation: Overnight at 4°C with gentle rocking

  • Secondary antibody: Anti-rabbit HRP conjugate at manufacturer's recommended dilution

• Detection and controls:

  • Enhanced chemiluminescence (ECL) detection is suitable for most applications

  • Positive control: HeLa cell lysate (confirmed to express CNPY4)

  • Loading control: Anti-GAPDH or anti-β-actin for normalization

  • Expected band size: 28 kDa

• Troubleshooting considerations:

  • Multiple bands: May indicate degradation, post-translational modifications, or non-specific binding

  • No signal: Check positive control, antibody dilution, and exposure time

  • High background: Increase blocking time or washing steps, decrease antibody concentration

Following these optimized conditions should yield reliable and reproducible detection of CNPY4 protein in Western blot applications.

How can researchers distinguish between effects of CNPY4 and other CNPY family members in experimental systems?

Distinguishing between CNPY family members (CNPY1-4) is crucial for accurate interpretation of experimental results. Recommended approaches include:

• Antibody selection:

  • Use highly specific antibodies raised against unique epitopes of CNPY4

  • Validate antibody specificity against recombinant CNPY family proteins

  • The immunogen sequence "IPLELWDEPSVEVTYLKKQCETMLEEFEDIVGDWYFHHQEQPLQNFLCEGHVLPAAETACLQETWTGKEITDGEEKTEGEEEQEEEEEEEEEEGGDKMTKTGSHPKLDRED" is unique to CNPY4 and not shared with other family members

• Expression analysis:

  • Perform qRT-PCR with primers specific to each CNPY family member

  • Compare expression patterns across tissues or cell types, as family members often show distinct tissue distribution

• Functional studies:

  • Design siRNAs or shRNAs that target unique regions of CNPY4 mRNA

  • Verify knockdown specificity by measuring expression of all family members

  • Use CRISPR-Cas9 for gene-specific knockout studies

• Rescue experiments:

  • Express CNPY4 in knockout/knockdown systems to confirm phenotype specificity

  • Test cross-rescue with other CNPY family members to identify shared functions

• Pathway analysis:

  • CNPY4 specifically inhibits the Hedgehog pathway by modulating membrane sterols

  • Other CNPY family members may affect different signaling pathways

  • Use pathway-specific reporters to differentiate functional effects

What are the critical considerations when using CNPY4 antibodies for studying its role in immune cell infiltration?

When investigating CNPY4's role in immune cell infiltration, particularly in the context of tumors, several critical considerations should be addressed:

• Antibody validation in immune contexts:

  • Confirm antibody specificity in relevant immune cell populations

  • Validate antibody performance in both fresh and fixed immune tissue samples

  • Use appropriate positive controls (e.g., tissues with known CNPY4 expression patterns)

• Multiplex immunostaining approaches:

  • Combine CNPY4 antibody with markers for specific immune cell populations (e.g., CD3 for T cells, CD20 for B cells, CD68 for macrophages)

  • Recommended dilution range for multiplex applications: 1:100-1:200

  • Account for potential antibody cross-reactivity when designing multiplex panels

• Analytical considerations:

  • Quantify both CNPY4 expression levels and immune cell densities

  • Analyze spatial relationships between CNPY4+ cells and immune infiltrates

  • Consider both the tumor core and invasive margin for comprehensive assessment

• Correlation with functional data:

  • In gliomas, CNPY4 expression correlates with infiltration of multiple immune cell types, with different patterns in GBM versus LGG

  • The proportion of resting NK cells is significantly higher in high CNPY4 expression groups (p = 0.018), while activated NK cells (p = 0.008) and M2 macrophages (p = 0.034) are reduced

  • These correlations suggest functional relationships that should be validated experimentally

• Integration with genomic and transcriptomic data:

  • Combine protein-level analyses with RNA sequencing data

  • Consider the influence of tumor mutations (e.g., IDH status in gliomas) on CNPY4-immune cell relationships

  • Use GSEA to identify enriched immune-related pathways associated with CNPY4 expression

By addressing these considerations, researchers can generate robust data on CNPY4's role in regulating immune cell infiltration in various pathological contexts, potentially identifying new therapeutic strategies for immunomodulation.

What are common pitfalls when working with CNPY4 antibodies and how can they be addressed?

Researchers may encounter several challenges when working with CNPY4 antibodies. Common issues and solutions include:

• Non-specific binding:

  • Issue: Detection of bands at unexpected molecular weights in Western blots

  • Solution: Increase blocking time (2-4 hours), optimize antibody dilution (start with 1:1000), and increase wash duration and frequency between antibody incubations

• Weak or absent signal:

  • Issue: No detection of CNPY4 despite appropriate sample selection

  • Solution: Ensure proper sample preparation (avoid proteolytic degradation), optimize antibody concentration, extend primary antibody incubation time (overnight at 4°C), use enhanced detection systems, and confirm CNPY4 expression in the sample using qRT-PCR

• High background in immunohistochemistry:

  • Issue: Excessive non-specific staining that obscures specific signal

  • Solution: Optimize antigen retrieval method, increase blocking time with 5-10% normal serum, reduce primary antibody concentration (try 1:500 instead of 1:200), and extend wash steps

• Inconsistent results between applications:

  • Issue: Antibody works well in one application (e.g., WB) but not in others (e.g., IHC)

  • Solution: Different applications may require different antibody clones or preparations; verify that the selected antibody has been validated for your specific application

• Cross-reactivity with other CNPY family members:

  • Issue: Potential detection of CNPY1, CNPY2, or CNPY3 in addition to CNPY4

  • Solution: Select antibodies raised against unique regions of CNPY4, perform validation using recombinant proteins of all family members, and include appropriate knockout/knockdown controls

Addressing these common pitfalls through systematic optimization and validation will significantly improve experimental outcomes when working with CNPY4 antibodies.

How can researchers effectively design experiments to study CNPY4's role in membrane sterol regulation?

Designing experiments to study CNPY4's role in membrane sterol regulation requires a multi-faceted approach:

• Loss-of-function models:

  • siRNA-mediated knockdown in cell lines (e.g., NIH3T3) with verification of knockdown efficiency by qRT-PCR and Western blot

  • CRISPR-Cas9 knockout in relevant cell lines

  • Knockout mouse models to study developmental phenotypes related to sterol dysregulation

• Membrane sterol quantification methods:

  • Fluorescent protein probe assay: Use modified Perfringolysin O (PFO*) coupled to a fluorescent tag to measure accessible sterols in the plasma membrane of intact cells

  • Lipidomic analysis: Perform LC-MS/MS to quantify specific sterol species in membrane fractions

  • Filipin staining: Visualize free cholesterol distribution in fixed cells

• Hedgehog pathway activity assessment:

  • Luciferase reporter assays measuring Gli expression in response to various HH pathway agonists

  • qRT-PCR analysis of endogenous HH target genes (Gli1, Ptch1)

  • Immunofluorescence for ciliary localization of Smoothened (SMO)

• Experimental design considerations:

  • Include multiple timepoints to capture dynamic changes in sterol levels

  • Compare effects of CNPY4 manipulation across different cell types

  • Design rescue experiments where wild-type CNPY4 is re-expressed in knockout cells

  • Include positive controls (e.g., treatment with sterol synthesis inhibitors or cholesterol depletion agents)

• Data analysis approach:

  • Quantify membrane sterol levels in CNPY4 knockdown versus control cells

  • Correlate sterol levels with HH pathway activation markers

  • Analyze dose-response relationships between CNPY4 expression and sterol levels

This experimental design framework enables comprehensive investigation of how CNPY4 regulates membrane sterols and consequently influences developmental signaling pathways like Hedgehog.

How do findings from CNPY4 studies in cancer compare with other pathological contexts?

CNPY4 has been studied primarily in the context of gliomas and developmental disorders, but comparing findings across pathological contexts reveals important insights:

• Cancer contexts:

  • In gliomas, CNPY4 expression correlates with immune cell infiltration patterns, with different relationships in GBM versus LGG

  • Univariate analysis shows association between CNPY4 expression and tumor grade, age, IDH status, and 1p/19q codeletion

  • Downregulation of CNPY4 expression appears to be an independent positive prognostic factor in glioma patients

• Developmental contexts:

  • CNPY4 knockout mouse embryos display polydactyly and other developmental abnormalities

  • These phenotypes are consistent with dysregulation of the Hedgehog signaling pathway

  • The developmental role appears to involve regulation of membrane sterols that influence morphogen signaling

• Methodological considerations for cross-context studies:

  • Use consistent antibodies across different pathological samples to ensure comparable results

  • Apply multiple detection methods (IHC, WB, IF) to validate findings

  • Integrate protein expression data with functional assays specific to each context

  • Compare CNPY4 expression patterns with known pathway markers in each disease context

• Reconciling seemingly divergent findings:

  • The immunoregulatory role of CNPY4 in cancer may be mechanistically linked to its sterol-modulating function

  • Membrane sterol composition affects immune cell function and receptor signaling

  • Design experiments that simultaneously assess CNPY4's effects on both sterol levels and immune parameters

By comparing CNPY4 functions across different pathological contexts while using rigorous methodological approaches, researchers can develop a more comprehensive understanding of this protein's diverse biological roles.

What emerging technologies might enhance CNPY4 antibody-based research?

Several cutting-edge technologies hold promise for advancing CNPY4 antibody-based research:

• Proximity Ligation Assays (PLA):

  • Enables visualization of protein-protein interactions in situ

  • Could identify CNPY4 binding partners in the sterol regulation pathway

  • Requires highly specific antibodies against CNPY4 and potential interacting proteins

• Mass Cytometry (CyTOF):

  • Allows simultaneous detection of >40 proteins at single-cell resolution

  • Could map CNPY4 expression across diverse immune and tumor cell populations

  • Would require metal-conjugated CNPY4 antibodies with validated specificity

• Spatial Transcriptomics combined with Immunohistochemistry:

  • Correlates CNPY4 protein localization with transcriptional profiles in tissue context

  • Provides insights into spatial relationships between CNPY4+ cells and specific microenvironmental features

  • Requires optimization of CNPY4 antibodies for compatibility with RNA detection protocols

• Super-Resolution Microscopy:

  • Enables visualization of CNPY4 subcellular localization at nanometer resolution

  • Could clarify how CNPY4 interacts with membrane components to regulate sterol levels

  • Requires highly specific fluorophore-conjugated antibodies

• Antibody Engineering Approaches:

  • Development of nanobodies or single-domain antibodies against CNPY4

  • Creation of bispecific antibodies targeting CNPY4 and key pathway components

  • Generation of antibody fragments for improved tissue penetration in imaging applications

These technologies could significantly enhance our understanding of CNPY4's molecular functions and cellular interactions, potentially revealing new therapeutic targets in cancer and developmental disorders.

What are the unresolved questions regarding CNPY4 function that warrant further investigation?

Despite recent advances, several critical questions about CNPY4 remain unanswered and represent important areas for future research:

• Molecular mechanism of sterol regulation:

  • How exactly does CNPY4 modulate membrane sterol levels?

  • Does it interact directly with sterol transport proteins or influence sterol synthesis/trafficking pathways?

  • What specific sterol species are most affected by CNPY4 activity?

• Regulation of CNPY4 expression:

  • What transcription factors and signaling pathways control CNPY4 expression?

  • Are there post-translational modifications that regulate CNPY4 protein stability or function?

  • How is CNPY4 expression altered in different pathological contexts?

• Immune regulatory functions:

  • What is the mechanistic basis for CNPY4's correlation with immune cell infiltration in gliomas?

  • Does CNPY4 directly influence immune cell function or indirectly affect the tumor microenvironment?

  • Could CNPY4 modulation enhance immune-based cancer therapies?

• Clinical significance:

  • Can CNPY4 expression serve as a reliable prognostic or predictive biomarker in multiple cancer types?

  • Does CNPY4 contribute to treatment resistance mechanisms?

  • Is CNPY4 itself a viable therapeutic target?

• Developmental roles beyond Hedgehog signaling:

  • What other developmental pathways might be influenced by CNPY4-mediated sterol regulation?

  • Are there tissue-specific functions of CNPY4 during embryogenesis?

  • Do CNPY4 mutations contribute to human developmental disorders?

Addressing these questions will require integrated approaches combining biochemical, cellular, developmental, and clinical studies, with CNPY4 antibodies serving as essential tools throughout this research.