CNTN2 Antibody

What is CNTN2 and what is its biological significance?

CNTN2 (contactin 2) is an immunoglobulin cell adhesion molecule (IgCAM) expressed on neural cell surfaces. It plays critical roles in the development and maintenance of the nervous system, including regulation of myelin sheath formation, facilitation of communication between neurons and axoglial cells, and coordination of neural cell migration . Structurally, full-length human CNTN2 forms a concentration-dependent homodimer with a distinctive bowknot-shaped scaffold consisting of Ig1-6 repeats from two protomers, with flexible ribbon-like FNIII repeats extending outward in opposite directions . This unique architecture is essential for maintaining cell-cell contacts within the nervous system, highlighting CNTN2's fundamental importance in neural connectivity.

What types of CNTN2 antibodies are available for research applications?

CNTN2 antibodies are available in multiple formats including rabbit polyclonal and mouse monoclonal variants. For example, Sigma-Aldrich offers a rabbit polyclonal CNTN2 antibody (HPA001397) specifically tested for immunohistochemistry applications . Proteintech provides a mouse monoclonal CNTN2 antibody (67089-1-Ig) validated for Western Blot (WB), immunohistochemistry (IHC), immunofluorescence (IF-P), and ELISA applications . When selecting a CNTN2 antibody, researchers should consider species reactivity (human, mouse, pig), antibody class, and validated applications. The molecular weight of CNTN2 is calculated at 113 kDa but may be observed between 113-135 kDa in experimental conditions .

How do the structural domains of CNTN2 influence antibody selection and experimental design?

The structure of CNTN2 consists of multiple domains that include six immunoglobulin-like (Ig) domains followed by four fibronectin type III (FNIII) domains and a GPI anchor. Recent cryo-EM studies have shown that the Ig1-6 domains, rather than just the previously proposed Ig1-4 domains, are crucial for CNTN2-dependent cell adhesion and clustering . This structural insight has important implications for antibody selection, as antibodies targeting different epitopes within these domains may differentially affect CNTN2 function. When designing experiments to study CNTN2-mediated cell adhesion, researchers should consider antibodies that specifically recognize epitopes within the Ig1-6 region, particularly at the dimerization interface. Mutations in residues such as L330E, R355A, and R506A at key homodimer contact sites have been shown to significantly reduce cell clustering, highlighting critical regions that may be targeted or blocked by specific antibodies .

What are the recommended protocols for using CNTN2 antibodies in immunohistochemistry?

For immunohistochemistry applications with CNTN2 antibodies, researchers should follow these methodological guidelines:

• Antigen retrieval: Use TE buffer at pH 9.0, although citrate buffer at pH 6.0 may also be used as an alternative .

• Recommended dilution range: For IHC applications, use a dilution range of 1:50-1:500, with optimal dilution being sample-dependent .

• Validated tissues: CNTN2 antibodies have been validated on mouse brain tissue for IHC applications .

• Detection method: Standard secondary antibody detection systems are compatible with CNTN2 antibodies.

• Controls: Include appropriate positive controls (preferably brain tissue) and negative controls (omitting primary antibody) to validate specificity.

Researchers should note that for rabbit polyclonal antibodies like HPA001397, vendor-specific protocols may be available through resources like the Human Protein Atlas project for optimal results .

What are the best practices for Western blot detection of CNTN2?

For optimal Western blot detection of CNTN2, follow these methodological recommendations:

• Sample preparation: CNTN2 is most highly expressed in neural tissues; therefore, brain, cerebellum, or spinal cord tissues are ideal positive controls .

• Protein loading: Load 20-40 μg of total protein per lane for tissue lysates.

• Antibody dilution: Use a dilution range of 1:500-1:2000 for primary antibody incubation .

• Expected molecular weight: Look for bands between 113-135 kDa, as observed in experimental conditions .

• Blocking solution: Use 5% non-fat dry milk or BSA in TBST.

• Membrane type: PVDF membranes are recommended for optimal protein transfer and antibody binding.

Remember that CNTN2 is a membrane-associated protein with post-translational modifications, which may affect its migration pattern on SDS-PAGE gels. Proper positive controls from neural tissues should be included to validate antibody specificity.

How should immunofluorescence experiments with CNTN2 antibodies be optimized?

For immunofluorescence experiments with CNTN2 antibodies, researchers should implement the following methodological approach:

• Sample preparation: Use 4% paraformaldehyde fixation followed by permeabilization with 0.1-0.3% Triton X-100.

• Antibody dilution: For immunofluorescence (IF-P), use a dilution range of 1:200-1:800 .

• Validated tissues: Mouse brain tissue has been validated for IF-P applications .

• Blocking solution: Use 1-5% BSA or normal serum (from the species of secondary antibody) in PBS with 0.1% Tween-20.

• Co-staining considerations: When performing co-localization studies, pair CNTN2 antibodies with markers for nodes of Ranvier, juxtaparanodes, or other relevant neural structures.

• Confocal imaging parameters: Use appropriate excitation/emission settings based on secondary antibody fluorophores, and minimize bleed-through by sequential scanning.

CNTN2 should localize primarily to cell-cell junctions and membrane surfaces in transfected cells. Studies have shown that CNTN2 Ig1-6 domains exhibit a more distinct presence on the cell membrane compared to wild-type full-length CNTN2 .

How do CNTN2 antibodies help distinguish between different structural conformations of the protein?

CNTN2 forms complex tertiary and quaternary structures that are critical to its function. Recent cryo-EM studies have revealed that full-length human CNTN2 forms a concentration-dependent homodimer with a novel bowknot-shaped scaffold . Specialized antibodies can be used to distinguish between monomeric and dimeric forms of CNTN2 through careful epitope selection.

Structurally-selective CNTN2 antibodies should target:

• Dimerization interfaces: Regions involving the Ig5-6 repeats that are only exposed in monomeric forms

• Conformational epitopes: Those present only when the protein adopts specific three-dimensional arrangements

• Critical residues: Key amino acids like L330, R355, and R506, which are essential for dimerization

These structure-specific antibodies can help researchers investigate how CNTN2 dimerization influences its biological functions. For example, mutational studies have shown that disrupting the homodimer interface significantly reduces cell-cell adhesion, indicating that dimerization is essential for CNTN2-mediated cell contacts . Antibodies recognizing these interface regions could serve as valuable tools for studying CNTN2 assembly dynamics in both physiological and pathological contexts.

What are the methodological considerations for investigating CNTN2 autoantibodies in neurological disorders?

CNTN2 autoantibodies have been detected in a small fraction of multiple sclerosis (MS) patients, warranting specific methodological approaches for their investigation . When studying CNTN2 autoantibodies in neurological disorders, researchers should consider:

• Patient cohort selection: Include various MS subtypes (clinically isolated syndromes, relapsing-remitting, secondary-progressive, and primary-progressive) as CNTN2 autoantibodies have not shown ability to differentiate between these conditions .

• Detection methods: Employ multiple techniques including:

  • ELISA for screening large cohorts

  • Cell-based assays using CNTN2-transfected cells for confirmation

  • Immunohistochemistry on tissue sections to evaluate binding patterns

• Isotype characterization: Determine antibody isotypes (IgG1, IgG2, IgG3, IgG4), as this provides insight into potential pathogenic mechanisms. For comparison, anti-CNTN1 antibodies in CIDP are predominantly IgG4, an isotype that doesn't efficiently promote inflammation .

• Functional assays: Assess the functional impact of autoantibodies on:

  • CNTN2-dependent cell adhesion

  • Node of Ranvier integrity

  • Blood-brain barrier permeability (relevant to the "two-hit" model proposed for MS pathogenesis)

• Correlation with clinical features: Analyze relationships between antibody titers and disease activity, MRI findings, and treatment responses.

Research has suggested that CNTN2 may serve as a sensitive marker of gray-matter disease in MS, potentially through immune-mediated inflammation against CNTN2 on gray-matter endothelial cells that opens the blood-brain barrier, allowing demyelinating agents to enter the gray matter .

How can CNTN2 antibodies be utilized to investigate the "two-hit" model in demyelinating diseases?

The "two-hit" model proposed for multiple sclerosis pathogenesis suggests that immune-mediated inflammation against CNTN2 on gray-matter endothelial cells facilitates blood-brain barrier (BBB) disruption, allowing demyelinating agents such as antibodies to myelin proteins to enter the gray matter . To investigate this model using CNTN2 antibodies, researchers should consider the following methodological approach:

• In vitro BBB models:

  • Utilize transwell systems with brain endothelial cells expressing CNTN2

  • Apply CNTN2 antibodies to the luminal side and measure permeability changes

  • Assess transmigration of immune cells across the BBB following CNTN2 antibody binding

• Animal model studies:

  • Replicate the experimental design described in the literature where anti-MOG antibodies were administered after contactin 2-specific T cells, which produced widespread demyelination in both white and gray matter

  • Use immunohistochemistry with anti-CNTN2 antibodies to track CNTN2 expression on endothelial cells before and after immune activation

  • Employ confocal microscopy to visualize BBB integrity using standard markers in conjunction with CNTN2 antibodies

• Human tissue analysis:

  • Examine MS patient brain samples for CNTN2 expression patterns on blood vessels in gray matter

  • Correlate CNTN2 antibody binding with evidence of BBB disruption and demyelination

  • Perform dual-labeling with CNTN2 antibodies and markers of endothelial damage or inflammation

This methodological approach allows researchers to systematically test the hypothesis that CNTN2 serves as a crucial target in the initial breach of the BBB, potentially identifying new therapeutic targets for preventing gray matter pathology in MS.

How should researchers address potential cross-reactivity issues with CNTN2 antibodies?

When working with CNTN2 antibodies, cross-reactivity with other contactin family members is a significant concern due to structural similarities. To address and minimize these issues, researchers should implement the following methodological approaches:

• Epitope verification: Review the immunogen sequence used to generate the antibody. For example, the rabbit polyclonal antibody HPA001397 uses a specific sequence (PASPSANATTMKPPPRRPPGNISWTFSSSSLSIKWDPVVPFRNESAVTGYKMLYQNDLHLTPTLHLTGKNWIEIPVPEDIGHALVQIRTTGPGGDGIPAEVHIVRNGGTSMMVENMAVRPAPHPGTVISHSVAMLIL) as its immunogen . Perform sequence alignment with other contactin family members to identify potential cross-reactive regions.

• Validation controls:

  • Positive controls: Include samples with confirmed CNTN2 expression (e.g., brain tissue)

  • Negative controls: Utilize tissues known to lack CNTN2 expression

  • Knockdown/knockout validation: Where possible, use CNTN2 knockdown or knockout samples to confirm antibody specificity

  • Preabsorption testing: Preincubate the antibody with purified CNTN2 protein before application to confirm signal reduction

• Dual antibody approach: Use two different CNTN2 antibodies targeting distinct epitopes to confirm specificity - concordant results increase confidence in specific detection.

• Specificity testing against related proteins: Test against samples expressing other contactin family members (CNTN1, CNTN3-6) to rule out cross-reactivity, particularly important when studying multiple contactins in the same system.

By implementing these methodological controls, researchers can significantly enhance confidence in their CNTN2 antibody specificity and generate more reliable experimental data.

What are the most common technical challenges when using CNTN2 antibodies and how can they be overcome?

Researchers commonly encounter several technical challenges when working with CNTN2 antibodies. Here are methodological solutions to address these issues:

• Weak or inconsistent signal intensity:

  • Solution: Optimize antibody concentration through careful titration experiments. For immunohistochemistry, test dilutions from 1:50-1:500; for Western blot, try 1:500-1:2000; and for immunofluorescence, use 1:200-1:800 .

  • Enhancement method: For IHC, implement antigen retrieval with TE buffer at pH 9.0 or alternatively with citrate buffer at pH 6.0 .

  • Storage consideration: Store antibodies at -20°C in aliquots to prevent freeze-thaw cycles that can degrade antibody quality .

• Background staining:

  • Solution: Implement more stringent blocking procedures using 3-5% BSA or normal serum from the secondary antibody species.

  • Washing protocol: Extend wash steps (3-5 washes of 5-10 minutes each) with 0.1% Tween-20 in PBS.

  • Secondary antibody optimization: Use highly cross-adsorbed secondary antibodies to minimize non-specific binding.

• Unexpected molecular weight bands in Western blot:

  • Solution: Be aware that CNTN2 may appear between 113-135 kDa due to post-translational modifications .

  • Sample preparation: Include protease inhibitors during tissue lysis to prevent degradation products.

  • Denaturation conditions: Optimize SDS-PAGE sample preparation with attention to heating temperature and duration.

• Inconsistent cell membrane localization:

  • Solution: Note that full-length CNTN2 and its Ig1-6 domains show localization at cell-cell junctions, with Ig1-6 displaying a more distinct presence on the cell membrane compared to wild-type protein .

  • Fixation optimization: Use gentle fixation methods (2-4% PFA) to preserve membrane structures.

  • Permeabilization control: Use low concentrations of detergents (0.1% Triton X-100) to minimize disruption of membrane proteins.

By implementing these methodological refinements, researchers can improve the reliability and reproducibility of their experiments with CNTN2 antibodies.

How can researchers quantitatively analyze CNTN2 expression patterns in tissue samples?

Quantitative analysis of CNTN2 expression in tissue samples requires rigorous methodological approaches to ensure accuracy and reproducibility. Researchers should follow these procedures:

• Image acquisition standardization:

  • Use consistent microscope settings (exposure time, gain, offset) across all samples

  • Acquire images at appropriate resolution (minimum 1024×1024 pixels)

  • Include internal calibration standards in each imaging session

• Quantification methods for IHC/IF samples:

  • Area measurement: Calculate percentage of tissue area with positive CNTN2 staining

  • Intensity measurement: Use mean fluorescence intensity (MFI) or optical density

  • Colocalization analysis: Calculate Pearson's or Mander's coefficients when performing double-labeling studies

  • Distribution analysis: Measure membrane vs. cytoplasmic signals using line scan profiles

• Western blot quantification:

  • Normalize CNTN2 band intensity to appropriate loading controls (β-actin, GAPDH)

  • Use standard curves with recombinant CNTN2 for absolute quantification

  • Employ densitometry software with background subtraction capabilities

• Statistical analysis recommendations:

  • Use appropriate statistical tests based on data distribution

  • Account for biological and technical replicates in experimental design

  • Calculate intra- and inter-observer variabilities when manual scoring is involved

• Software tools:

  • ImageJ/FIJI with appropriate plugins for automated analysis

  • CellProfiler for high-throughput cellular phenotype quantification

  • QuPath for whole-slide image analysis of CNTN2 IHC

When analyzing CNTN2 in clinical samples, researchers should be aware that CNTN2 autoantibodies do not differentiate between early occurrence and stages of MS (clinically isolated syndromes, relapsing–remitting, secondary-progressive, and primary-progressive) or different MRI profiles , suggesting that quantitative analysis should focus on regional distribution patterns rather than simple presence/absence.

What is the relationship between CNTN2 antibodies and demyelinating disorders?

CNTN2 antibodies have significant implications in demyelinating pathologies, particularly in multiple sclerosis (MS). Unlike CNTN1 antibodies which are predominantly associated with chronic inflammatory demyelinating polyneuropathy (CIDP), autoantibodies to CNTN2 are detected in a small fraction of MS patients . The relationship between CNTN2 antibodies and demyelinating disorders involves several key mechanisms:

This relationship between CNTN2 antibodies and demyelinating disorders represents an important area for continued research, potentially leading to new diagnostic and therapeutic approaches for MS and related conditions.

How does the structural conformation of CNTN2 influence its functional roles in neural systems?

The structural conformation of CNTN2 is critical to its diverse functional roles in neural systems. Recent cryo-EM studies have provided significant insights into structure-function relationships:

• Dimerization and cell adhesion: Full-length human CNTN2 forms a concentration-dependent homodimer with a distinctive bowknot-shaped scaffold comprised of Ig1-6 repeats from two protomers, with flexible FNIII repeats extending outward in opposite directions . This dimerization is essential for cell adhesion and clustering, as demonstrated through structure-guided mutagenesis analyses .

• Domain-specific functions:

  • Ig1-6 domains: These domains, rather than just the previously proposed Ig1-4 domains, are indispensable for mediating CNTN2-dependent cell adhesion and clustering . Cell adhesion experiments showed that CNTN2 Ig1-6 domains could support cell-cell adhesion and clustering, while Ig1-4 domains alone could not .

  • FNIII domains: When expressed without the Ig domains, FNIII struggles to exit the nucleus and operate on the cell surface, indicating it doesn't contribute to cell adhesion independently .

• Critical interface residues: Mutations in key residues at the CNTN2 dimerization interface (L330E, R355A, R506A, or R355/506A) resulted in a noticeable decrease in cell clustering . Cells expressing the CNTN2 R355/506A mutant exhibited significantly reduced aggregation compared to those expressing wild-type CNTN2 .

• Higher-order assemblies: Two-dimensional classification analysis has indicated the presence of higher-order oligomeric states, such as dimers or trimers of CNTN2 dimers . This suggests multiple modes in CNTN2 homophilic interactions, with the Ig1-6-mediated dimer serving as the basic unit for its higher-order assembly .

These structural insights provide a molecular basis for understanding how CNTN2 maintains cell-cell contacts in the nervous system, offering potential targets for therapeutic interventions in conditions where CNTN2 function is compromised.

What are the most effective experimental systems for investigating CNTN2 function in neural development?

To effectively investigate CNTN2 function in neural development, researchers should consider the following experimental systems and methodological approaches:

• Cell culture models:

  • Transfected cell lines: HEK293F cells transfected with CNTN2 constructs provide a valuable system for studying cell adhesion properties. This approach has revealed that CNTN2 Ig1-6 domains, but not Ig1-4 domains alone, can support cell-cell adhesion and clustering .

  • Primary neural cultures: Neurons and glial cells cultured from wild-type and CNTN2-knockout animals allow for detailed analysis of CNTN2's role in axon-glia interactions and myelination.

  • iPSC-derived neural cells: Patient-derived induced pluripotent stem cells differentiated into neurons provide a human-relevant system to study CNTN2 function in development and disease contexts.

• Organoid systems:

  • Brain organoids: 3D cultures that recapitulate aspects of brain development can reveal CNTN2's role in complex cellular organization.

  • Myelinating co-culture systems: Co-cultures of neurons and oligodendrocytes allow for detailed analysis of CNTN2's function in myelination processes.

• In vivo models:

  • Transgenic mouse models: CNTN2 knockout or conditional knockout mice enable the study of CNTN2's developmental roles in specific neural cell types or regions.

  • In utero electroporation: This technique allows for manipulation of CNTN2 expression in specific neural populations during embryonic development.

  • Zebrafish models: These provide advantages for high-throughput screening and live imaging of neural development processes.

• Advanced imaging approaches:

  • Super-resolution microscopy: Techniques like STORM or STED microscopy can resolve CNTN2 localization at the nanoscale level, particularly at specialized junctions like nodes of Ranvier.

  • Live-cell imaging: Time-lapse microscopy of fluorescently tagged CNTN2 can reveal dynamic aspects of its function during neural development.

• Molecular interaction analysis:

  • Proximity ligation assays: These can detect and visualize protein-protein interactions involving CNTN2 in situ.

  • Co-immunoprecipitation: This technique can identify binding partners of CNTN2 during different developmental stages.

  • Structure-guided mutagenesis: Based on cryo-EM structural data, researchers can generate specific mutations (e.g., L330E, R355A, R506A) to disrupt CNTN2 dimerization and assess functional consequences .

By combining these experimental systems and methodological approaches, researchers can comprehensively investigate CNTN2's multifaceted roles in neural development, from molecular interactions to system-level functions.

What are the optimal antibody dilutions and applications for different CNTN2 antibody types?

What structural characteristics of CNTN2 are important for experimental design?

What is the cryo-EM data collection and refinement statistics for CNTN2 structural studies?