cobl Antibody

Biological Context of Cobl Protein

The Cobl protein (Cordon-bleu) is a brain-enriched actin nucleator that regulates the formation of actin filaments via its three Wiskott-Aldrich syndrome protein Homology 2 (WH2) domains . Its functions include:

• Cytoskeletal Organization: Essential for Purkinje cell dendritic arborization and enterocyte brush border formation .

• Tissue Expression: High levels in adult small intestine (jejunum, ileum) and colon, with low expression during early development .

Structure and Validation of Anti-COBL Antibodies

The HPA019167 antibody (Sigma-Aldrich) is a rabbit-derived polyclonal antibody optimized for:

• Immunogen: Sequence AVVRVSPEVPLQNILPVICAKCEVSPEHVVLLRDNIAGEELELSKSLNELGIKELYAWDNRRETFRKSSLGNDETDKEKKKFLGFFKVNKRSNSKGCLT .

• Applications:

  Technique	Dilution/Concentration	Notes
  Immunoblotting	0.04–0.4 μg/mL	Detects 120 kDa protein
  Immunofluorescence	0.25–2 μg/mL	Cytoplasmic staining
  Immunohistochemistry	1:50–1:200	Enterocyte enrichment

Validation includes RNAi knockdown and orthogonal RNAseq confirmation, ensuring specificity .

Cellular Morphogenesis

• Purkinje Cells: Cobl knockdown disrupts dendritic arborization, mirroring Abp1 knockdown phenotypes .

• Intestinal Enterocytes: Cobl KO mice exhibit elongated microvilli without altering density, highlighting its role in terminal web organization .

Protein Interactions

Cobl forms complexes with:

• Syndapin I: Coimmunoprecipitation confirmed in brain extracts .

• Abp1: Mediates actin dynamics in neurons .

Disease Relevance

• Cancer: Cobl-like isoforms regulate actin in prostate cancer cells .

• Neurodegeneration: Dysregulation linked to dendritic arborization defects .

Experimental Data

Future Directions

• Therapeutic Targeting: Cobl-like proteins in cancer suggest potential for actin-modulating therapies .

• Antibody Engineering: Recombinant antibodies for high-throughput screening .