COL4A3BP Antibody

Shipped with Ice Packs
In Stock

Description

Introduction to COL4A3BP Antibody

COL4A3BP antibody is a specialized immunoglobulin designed to recognize and bind to collagen type IV alpha-3 binding protein (COL4A3BP), also known as ceramide transfer protein (CERT) or START domain-containing protein 11 (STARD11). This antibody is predominantly produced in rabbit hosts as polyclonal immunoglobulins with demonstrated reactivity against human, mouse, and rat COL4A3BP protein . Commercial preparations typically feature affinity-purified formulations that provide high specificity and minimal cross-reactivity, making them valuable tools for detecting COL4A3BP expression in various experimental systems .

The antibody production process generally involves immunizing rabbits with specific immunogens such as synthetic peptides derived from human COL4A3BP protein sequences or recombinant protein fragments. For instance, some manufacturers utilize recombinant fusion proteins containing amino acid sequences corresponding to positions 369-598 of human COL4A3BP (NP_112729.1) . These carefully selected immunogenic regions ensure that the resulting antibodies exhibit optimal binding characteristics and specificity.

Commercial preparations of COL4A3BP antibodies are available from multiple manufacturers including Novus Biologicals (Bio-Techne), Assay Genie, Proteintech, ABClonal, Elabscience, and Atlas Antibodies, each offering slightly different formulations with varying specifications for research applications .

Molecular Structure and Function

The COL4A3BP gene encodes a kinase that specifically phosphorylates the N-terminal region of the non-collagenous domain of the alpha 3 chain of type IV collagen, known as the Goodpasture antigen . The protein has a calculated molecular weight of approximately 71 kDa, though it is often observed at 80-89 kDa in gel electrophoresis due to post-translational modifications .

COL4A3BP protein functions as a ceramide transfer protein (hence its alternative name CERT) that extracts ceramide from the endoplasmic reticulum and transports it to the Golgi apparatus . This ceramide trafficking function is critical for sphingolipid metabolism and membrane biogenesis. The protein contains specific domains that facilitate its lipid transfer activities, including the StAR-related lipid transfer (START) domain, which is responsible for ceramide binding and transport .

Cellular Localization and Expression

COL4A3BP exhibits a distinctive cellular distribution pattern, predominantly localizing to the cytoplasm, Golgi apparatus, and endoplasmic reticulum . This localization pattern aligns with its functional role in ceramide transport between these organelles. The protein is preferentially concentrated in the Golgi apparatus, reflecting its central role in sphingolipid metabolism and vesicular transport .

Expression analyses using COL4A3BP antibodies have demonstrated the presence of this protein in various tissues including brain, pancreas, kidney, thyroid, and gastric tissues . In particular, strong expression has been documented in human pancreas and kidney tissues, as well as in mouse brain tissue .

Biological Significance and Disease Associations

COL4A3BP plays critical roles in diverse biological processes, including:

  1. Ceramide intracellular transport and sphingolipid metabolism

  2. Cell adhesion, migration, and signaling

  3. Regulation of cell growth and survival

  4. Potential involvement in tumor progression and metastasis

Notably, COL4A3BP has been implicated in Goodpasture disease, an autoimmune condition resulting from an immune response directed against the Goodpasture antigen (the alpha 3 chain of type IV collagen) . Additionally, recent research utilizing COL4A3BP antibodies has suggested potential roles for this protein in cancer biology, with studies examining its expression in thyroid and gastric cancer tissues .

Specificity and Reactivity

COL4A3BP antibodies demonstrate specific reactivity against human, mouse, and rat samples, making them versatile tools for cross-species research applications . The antibodies recognize specific epitopes within the COL4A3BP protein, with various commercial products targeting different regions. For example, Atlas Antibodies' HPA035645 targets the PrEST antigen sequence "GEAITFKATTAGILATLSHCIELMVKREDSWQKRLDKETEKKRRTEEAYKNAMTELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALD" .

Validation studies performed by manufacturers have confirmed antibody specificity through techniques such as western blotting, immunohistochemistry, and immunofluorescence on verified sample types . Positive western blot detection has been reported in mouse brain tissue, HEK-293 cells, human pancreas tissue, mouse kidney tissue, mouse pancreas tissue, and rat brain tissue .

Antibody Formats and Formulations

Commercial COL4A3BP antibodies are available in various formats, with most products offered as unconjugated polyclonal rabbit IgG antibodies . These antibodies are typically supplied as liquid formulations in storage buffers containing phosphate-buffered saline (PBS) with preservatives such as sodium azide (0.02-0.08%) and stabilizers like glycerol (40-50%) .

The concentration of antibody preparations varies between manufacturers, with some products providing concentration information on the vial label and others specifying typical concentrations (e.g., 0.4 mg/mL) . Most products are offered in volumes ranging from 20 μL to 100 μL, with some manufacturers providing multiple size options to accommodate different research needs .

Production and Purification Methods

COL4A3BP antibodies are predominantly produced through immunization of rabbits with carefully selected immunogens . The immunogens used include:

  1. Synthetic peptides derived from human COL4A3BP protein

  2. Recombinant fusion proteins containing amino acid sequences from human COL4A3BP

  3. Recombinant Protein Epitope Signature Tag (PrEST) antigens

Following immunization and antibody production, the antibodies undergo purification processes to enhance specificity and reduce background interference. Affinity purification represents the standard method employed across manufacturers, using the target antigen as an affinity ligand to isolate specific antibodies from serum .

Western Blotting

COL4A3BP antibodies are extensively validated for western blotting applications, with recommended dilutions typically ranging from 1:200 to 1:10,000 depending on the specific product and application conditions . Western blotting with these antibodies enables detection of COL4A3BP protein at its expected molecular weight of approximately 71-89 kDa .

Table 1: Recommended Western Blot Dilutions for Different COL4A3BP Antibodies

ProductManufacturerRecommended WB DilutionObserved MW
NBP3-30940Novus Biologicals1:400Not specified
CAB15376Assay Genie1:200 - 1:200071 kDa
15191-1-APProteintech1:2000 - 1:1000080-89 kDa
A15376ABClonal1:200 - 1:200071 kDa
HPA035645Atlas Antibodies0.04-0.4 μg/mlNot specified

Studies utilizing these antibodies for western blotting have successfully detected COL4A3BP in various sample types, including mouse brain tissue, HEK-293 cells, human pancreas tissue, mouse kidney tissue, and rat brain tissue .

Immunohistochemistry

Immunohistochemical applications represent another important use for COL4A3BP antibodies, enabling the visualization of protein expression and localization in tissue sections . These antibodies have been validated for immunohistochemistry on human tissues including pancreas, kidney, thyroid cancer, and gastric cancer samples .

For optimal immunohistochemical staining, manufacturers recommend dilutions ranging from 1:50 to 1:500, with specific protocols often suggesting antigen retrieval methods such as heat-induced epitope retrieval (HIER) with either citrate buffer (pH 6.0) or TE buffer (pH 9.0) .

Immunofluorescence and Immunocytochemistry

COL4A3BP antibodies are also applicable for immunofluorescence and immunocytochemistry protocols, allowing for detailed subcellular localization studies . These applications have successfully visualized COL4A3BP in cell lines such as L929 cells with recommended dilutions typically ranging from 1:50 to 1:200 .

Atlas Antibodies' HPA035645, for instance, recommends PFA/Triton X-100 fixation/permeabilization protocols with working concentrations of 0.25-2 μg/ml for optimal immunofluorescence results .

Immunoprecipitation

Some COL4A3BP antibodies have been validated for immunoprecipitation applications, demonstrating the ability to pull down the target protein from complex biological samples . For example, Proteintech's 15191-1-AP has been validated for immunoprecipitation from mouse brain tissue with recommended usage of 0.5-4.0 μg antibody per 1.0-3.0 mg of total protein lysate .

Product Specs

Buffer
Phosphate-buffered saline (PBS) with 0.02% sodium azide, 50% glycerol, pH 7.3. Store at -20°C. Avoid repeated freeze-thaw cycles.
Lead Time
Typically, we can ship products within 1-3 business days after receiving your order. Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time estimates.
Synonyms
Alpha 3 type IV collagen binding protein antibody; C43BP_HUMAN antibody; Ceramide transfer protein antibody; Ceramide transporter antibody; CERT antibody; Cert protein antibody; CERTL antibody; col4a3bp antibody; Collagen type IV alpha 3 (Goodpasture antigen) binding protein antibody; Collagen type IV alpha 3 binding protein antibody; Collagen type IV alpha-3-binding protein antibody; FLJ20597 antibody; Goodpasture antigen binding protein antibody; Goodpasture antigen-binding protein antibody; GPBP antibody; hCERT antibody; Lipid transfer protein CERTL antibody; Procollagen type IV alpha 3 (Goodpasture antigen) binding protein antibody; StAR related lipid transfer (START) domain containing 11 antibody; StAR related lipid transfer protein 11 antibody; StAR-related lipid transfer protein 11 antibody; StARD 11 antibody; StARD11 antibody; START domain containing 11 antibody; START domain containing protein 11 antibody; START domain-containing protein 11 antibody
Target Names
COL4A3BP
Uniprot No.

Target Background

Function
CERT (ceramide transfer protein) is a protein that shelters ceramides and diacylglycerol lipids within its START domain. It facilitates the intracellular trafficking of these lipids in a non-vesicular manner, contributing to various cellular processes.
Gene References Into Functions
  1. CERT plays a crucial role in ER-to-Golgi ceramide transport, preserving muscle cell insulin signaling. PMID: 29759974
  2. The PH and START domains of CERT interact with each other, with the START domain binding to the PH domain at the PtdIns[4]P-binding site. Mutations disrupting this interaction enhance PtdIns[4]P-binding affinity and ceramide transfer activity. (PH domain = N-terminal pleckstrin homology domain; START domain = StAR-related lipid transfer domain; PtdIns[4]P = phosphatidylinositol 4-phosphate) PMID: 28652409
  3. Cells expressing mitoCERT import ceramides into mitochondria, triggering Bax-dependent apoptosis. PMID: 27888218
  4. Phosphorylation of CERT at the FFAT motif-adjacent serine influences its affinity for VAP, potentially regulating ceramide inter-organelle trafficking in response to alterations in cellular sphingomyelin or other sphingolipids. PMID: 24569996
  5. Both CERT isoforms bind to the globular head region of C1q when immobilized, initiating the classical complement pathway. C1q also binds endogenous CERTL on the surface of apoptotic cells. PMID: 24395916
  6. The pleckstrin homology domain of CERT mediates its association with the Golgi apparatus. PMID: 22869376
  7. CERT plays a central role in the PKD signaling network at the Golgi complex, integrating non-vesicular and vesicular transport processes. (Review) PMID: 22226883
  8. Loss of CERT enhances EGF receptor signaling in breast cancer. PMID: 22472120
  9. The START domain in GPBP is crucial for its interaction with SAP. SAP and GPBP form complexes in blood and partly colocalize in amyloid plaques from Alzheimer disease patients. PMID: 22396542
  10. This review focuses on ceramide transfer protein (CERT) as a key regulator of ceramide flux within cells. [review] PMID: 21707482
  11. During cellular stress, Golgi structure disassembly and caspase-mediated CERT inactivation lead to reduced ceramide trafficking and sphingomyelin synthesis, contributing to the cellular response to pro-apoptotic stress. PMID: 22129459
  12. The presence of IncD, CERT, VAPA/B, and potentially other host or bacterial factors at the interface between the ER and the inclusion membrane creates a specialized microenvironment conducive to bacterial development. PMID: 21731489
  13. CERT-dependent ceramide transport and subsequent conversion to sphingomyelin appear essential for C. trachomatis replication, while GBF1-dependent SM synthesis is crucial for inclusion growth and stability. PMID: 21909260
  14. GPBP directs myofibril formation through interaction with the intracellular effector 130-kDa GPBP-interacting protein. PMID: 21832087
  15. PKD negatively regulates HCV secretion/release by attenuating OSBP and CERT functions through phosphorylation inhibition, highlighting the critical role of Golgi components in HCV maturation. PMID: 21285358
  16. The membrane matrix surrounding ceramide, its miscibility, significantly affects the transfer activity of CERT. PMID: 20875392
  17. hBVR regulates the TNF-alpha-GPBP-collagen type IV signaling cascade. PMID: 20177069
  18. Crystal structures of the CERT START domain in complex with HPAs ((1R,3R)-N-(3-Hydroxy-1-hydroxymethyl-3-phenylpropyl)alkanamide) of varying acyl chain lengths have been determined. PMID: 20036255
  19. CERT mediates the intracellular trafficking of ceramide in a non-vesicular manner. PMID: 14685229
  20. CERT can mediate the transfer of various naturally occurring ceramide species and their close relatives. PMID: 15596449
  21. Crypticity is a feature of the quaternary structure of two subsets of alpha3alpha4alpha5(IV) NC1 hexamers: autoantibody-reactive M-hexamers containing only monomer subunits and autoantibody-impenetrable D-hexamers composed of dimer and monomer subunits. PMID: 15917228
  22. Results identify a human-specific TNF-responsive transcriptional unit that locates GPBP in the TNF signaling cascade, supporting previous findings linking TNF and GPBP to human autoimmunity. PMID: 16218959
  23. A clinical evaluation of probands and their relatives from five families carrying mutations in either the COL4A3 or COL4A4 gene has been conducted to elucidate the natural history of autosomal recessive Alport syndrome (ATS). PMID: 16338941
  24. Regulation of ceramide transport protein by oxysterol binding protein (OSBP) and VAMP reveals a novel mechanism for ceramide transport and sphingomyelin synthesis in the Golgi apparatus. PMID: 16571669
  25. The Golgi-targeting domain and endoplasmic reticulum-interacting FFAT motif of CERT spatially restrict the random ceramide transfer activity of the START domain in cells. PMID: 16895911
  26. Data show that CERT undergoes multiple phosphorylations at a serine-repeat motif, potentially a site for casein kinase I, and this phosphorylation down-regulates the ER-to-Golgi transport of ceramide. PMID: 17442665
  27. Regulation of secretory transport by PKD-mediated phosphorylation of CERT is reported. PMID: 17591919
  28. GPBP regulates GBM collagen organization, and its elevated expression causes dissociation and subsequent accumulation of IgA on the GBM. PMID: 17916599
  29. CERT is a physiological substrate of PP2Cepsilon, and its dephosphorylation by PP2Cepsilon may play a significant role in regulating ceramide trafficking from the ER to the Golgi apparatus. PMID: 18165232
  30. Analysis of the mechanism by which CERT distinguishes ceramide from other lipid types while still recognizing multiple ceramide species has been performed. PMID: 18184806
  31. Healthy individuals have low frequencies of unstimulated alpha3(IV)NC1-reactive T cells with specificities similar to the autoreactive T cells found in patients with Goodpasture disease. PMID: 18216317
  32. CERT can attenuate a key metabolic protective mechanism against ceramide-induced apoptosis in keratinocytes. PMID: 18411267
  33. Goodpasture antigen-binding protein (GPBP) is a soluble exportable protein that interacts with type IV collagen. PMID: 18772132
  34. CKIgamma2 hyperphosphorylates the serine-repeat motif of CERT, inactivating CERT and down-regulating sphingomyelin synthesis. PMID: 19005213
  35. The allergen causing the most food-induced anaphylaxis in Italy has been identified. PMID: 19494524

Show More

Hide All

Database Links

HGNC: 2205

OMIM: 604677

KEGG: hsa:10087

STRING: 9606.ENSP00000369862

UniGene: Hs.270437

Involvement In Disease
Mental retardation, autosomal dominant 34 (MRD34)
Subcellular Location
Cytoplasm. Golgi apparatus. Endoplasmic reticulum.
Tissue Specificity
Widely expressed.

Q&A

What is COL4A3BP and why is it important in research?

COL4A3BP (now also referred to as CERT1) encodes a kinase that specifically phosphorylates the N-terminal region of the non-collagenous domain of the alpha 3 chain of type IV collagen, known as the Goodpasture antigen . This protein has dual functions: as a kinase involved in phosphorylation events and as a ceramide transfer protein that mediates intracellular trafficking of ceramides in a non-vesicular manner . It is particularly important in research related to autoimmune conditions (as Goodpasture disease results from an autoimmune response directed at this antigen), lipid metabolism, and cellular signaling pathways .

What are the key isoforms of COL4A3BP and how do they differ?

The COL4A3BP gene is alternatively spliced, producing multiple protein isoforms with different functional properties:

  • GPBP (full-length variant) - Contains a serine-rich domain of 26 amino acid residues

  • GPBPΔ26 (shorter variant) - Lacks the serine-rich domain encoded by exon 11

These isoforms exhibit different binding capacities to the Goodpasture auto-antigen and different kinase activities. The full-length GPBP shows stronger binding and kinase activity compared to GPBPΔ26 . Both isoforms function as ceramide transfer proteins (CERT), but they are differentially expressed during development and may have distinct biological roles .

What is the cellular localization of COL4A3BP?

COL4A3BP is predominantly located in the cytoplasm, with preferential localization to the Golgi apparatus. It is also found in the endoplasmic reticulum . The protein contains domain structures that facilitate this localization:

  • An amino-terminal pleckstrin homology (PH) domain

  • A middle FFAT motif (two phenylalanines in acidic tract)

  • A carboxyl-terminal START domain

The PH domain permits localization to the Golgi apparatus, while the FFAT domain allows association with the endoplasmic reticulum, enabling the protein to transfer ceramides between these organelles .

What applications are COL4A3BP antibodies most commonly used for?

Based on the available data, COL4A3BP antibodies are validated for the following applications:

ApplicationValidated in SourcesCommon Dilutions
Western Blot (WB)Human, mouse, rat tissues1:2000-1:10000
Immunohistochemistry (IHC)Human thyroid cancer, gastric cancer, pancreas, kidney1:50-1:500
Immunoprecipitation (IP)Mouse brain tissue0.5-4.0 μg for 1.0-3.0 mg lysate
Immunofluorescence (IF)Cell lines (e.g., L929)1:50-1:200
ELISAVariousAs specified by protocol

The selection of application should be based on the specific research question and experimental system .

How should I optimize immunohistochemistry protocols for COL4A3BP antibodies?

For optimal IHC staining using COL4A3BP antibodies, consider the following methodological recommendations:

  • Antigen retrieval: Use TE buffer at pH 9.0 as the primary method; alternatively, citrate buffer at pH 6.0 can be used .

  • Dilution range: Begin with 1:50-1:200 dilution for polyclonal antibodies and adjust based on signal strength .

  • Verified samples: Human thyroid cancer, human gastric cancer, human pancreas, and human kidney tissues have been successfully used for IHC validation .

  • Blocking: Use 5% Milk-TBST for blocking and as antibody diluent for consistent results .

  • Incubation: For optimal binding, incubate primary antibody overnight at 4°C .

Always perform antibody titration in your specific testing system to obtain optimal results, as sensitivity may be sample-dependent .

What are the recommended protocols for Western blot using COL4A3BP antibodies?

For Western blot applications with COL4A3BP antibodies:

  • Sample preparation: Multiple tissue types have yielded positive results including mouse brain, HEK-293 cells, human pancreas, mouse kidney, and rat brain tissues .

  • Dilution range: Use 1:2000-1:10000 for primary antibody incubation .

  • Blocking conditions: 5% Milk-TBST is recommended for blocking and as antibody diluent .

  • Primary antibody incubation: Incubate overnight at 4°C for optimal results .

  • Expected molecular weight: The calculated molecular weight of COL4A3BP is 71 kDa, but the observed molecular weight in Western blots typically ranges from 80-89 kDa, likely due to post-translational modifications .

  • Secondary antibody: For rabbit-hosted COL4A3BP antibodies, use anti-rabbit IgG with appropriate conjugation (HRP is common) .

How can I address weak or no signal when using COL4A3BP antibodies?

If experiencing weak or no signal with COL4A3BP antibodies, consider these approaches:

  • Antibody dilution: Decrease the dilution factor (use more concentrated antibody) within the recommended range (e.g., start with 1:50 for IHC or 1:2000 for WB) .

  • Antigen retrieval: Ensure proper antigen retrieval by testing both recommended methods (TE buffer pH 9.0 and citrate buffer pH 6.0) .

  • Incubation time: Extend the primary antibody incubation time to overnight at 4°C .

  • Sample preparation: Verify protein expression in your specific sample type; consult the list of verified positive samples (mouse brain, HEK-293 cells, human pancreas tissue, etc.) .

  • Storage conditions: Ensure the antibody has been properly stored at -20°C and has not undergone multiple freeze-thaw cycles .

  • Verify antibody viability: Use a known positive control sample where COL4A3BP expression has been confirmed .

What factors should I consider when selecting between polyclonal and monoclonal COL4A3BP antibodies?

The choice between polyclonal and monoclonal antibodies should be guided by your specific research needs:

Polyclonal antibodies (like E-AB-14885, 15191-1-AP):

  • Recognize multiple epitopes on COL4A3BP, potentially increasing sensitivity

  • Useful for detecting low-abundance proteins or denatured proteins

  • Show broader species cross-reactivity (often reactive with human, mouse, and rat)

  • May have higher background in some applications

Monoclonal antibodies:

  • Recognize a single epitope, providing higher specificity

  • More consistent lot-to-lot with less background variation

  • Potentially lower sensitivity for detecting native proteins

  • May have more restricted species reactivity

For COL4A3BP research requiring detection of specific isoforms, consider the immunogen location relative to the alternative splicing region (exon 11). Many available antibodies are raised against recombinant proteins or N-terminal regions (residues 1-50), which may detect both GPBP and GPBPΔ26 isoforms .

How should I address background issues in immunohistochemistry with COL4A3BP antibodies?

High background in IHC can interfere with specific signal detection. To minimize background when using COL4A3BP antibodies:

  • Optimize blocking: Use 5% Milk-TBST or add 0.1% BSA to the blocking buffer as done in some validated protocols .

  • Antibody dilution: Use the highest dilution that still produces specific signal (e.g., 1:200 for IHC) .

  • Washing steps: Increase the number and duration of washes between antibody incubations.

  • Secondary antibody optimization: Ensure secondary antibody is properly diluted and has minimal cross-reactivity with the sample species.

  • Endogenous peroxidase quenching: For HRP-based detection systems, adequately quench endogenous peroxidase activity.

  • Evaluate fixation: Overfixation can increase background; test different fixation protocols if possible.

  • Test antibody specificity: Consider validating antibody specificity using knockout or knockdown controls .

How can I distinguish between COL4A3BP isoforms in experimental systems?

Distinguishing between GPBP and GPBPΔ26 isoforms requires specific methodological approaches:

  • PCR-based detection:

    • Design primers flanking exon 11 to generate amplicons of different sizes for the two splice variants

    • In zebrafish models, researchers successfully used this approach to identify both isoforms

  • Immunoblotting:

    • Both isoforms can be detected on Western blots with different mobility patterns

    • The full-length GPBP shows lower mobility compared to GPBPΔ26

    • The observed weight difference corresponds to the 26-amino acid serine-rich domain

  • Specific antibodies:

    • Consider using antibodies raised against the 26-amino acid region present only in the full-length isoform

    • For functional studies, recombinant expression of FLAG-tagged isoforms can be visualized using anti-FLAG antibodies

  • Functional assays:

    • Kinase activity assays can differentiate between isoforms, as GPBP shows stronger kinase activity

    • Ceramide transfer assays may also reveal functional differences between the isoforms

What knockout/knockdown approaches are effective for studying COL4A3BP function?

Several effective genetic manipulation strategies have been used to study COL4A3BP function:

  • CRISPR-Cas9 knockout:

    • Genome-wide CRISPR knockout screens have included COL4A3BP

    • This approach provides complete protein elimination but may affect all isoforms

  • Splice-blocking morpholinos:

    • In zebrafish, specifically designed morpholinos targeting exon 11 (MO gpbp-SA) effectively eliminated the full-length gpbp without affecting gpbpΔ26

    • This allows for isoform-specific functional studies

  • 5'UTR-targeting morpholinos:

    • Also used in zebrafish to knockdown all isoforms

    • Enables comparison with isoform-specific knockdown effects

  • Rescue experiments:

    • Synthetic mRNA co-injection with morpholinos can confirm specificity

    • Differential rescue with gpbp vs. gpbpΔ26 mRNAs revealed isoform-specific functions in development

The phenotypes associated with COL4A3BP knockdown in zebrafish included increased apoptosis in somites, brain edema, and loss of myelinated tracks, suggesting important roles in normal skeletal muscle and brain development .

How is COL4A3BP involved in disease pathogenesis and what research models are most appropriate?

COL4A3BP has been implicated in several disease contexts:

  • Autoimmune diseases:

    • Goodpasture disease involves autoimmune responses against the Goodpasture antigen (α3 chain of type IV collagen) that is phosphorylated by COL4A3BP

    • GPBP is overexpressed in many autoimmune conditions

  • Developmental disorders:

    • Mutations in CERT1 (COL4A3BP) are associated with intellectual developmental disorder (autosomal dominant 34)

    • Zebrafish models show that disruption of gpbp leads to developmental abnormalities in the brain and somites

  • Pulmonary vascular disease:

    • COL4A3BP has been identified in pathway analyses of pulmonary vascular disease, with significant adjusted P values (0.008843249)

  • Cancer research:

    • COL4A3BP antibodies have been validated in cancer tissues including thyroid cancer and gastric cancer

    • The protein is implicated in cancer, cell biology, metabolism, and signal transduction research areas

Appropriate research models include:

  • Zebrafish for developmental studies (allows isoform-specific manipulation)

  • Cell culture models for ceramide transport and Golgi-ER trafficking studies

  • Human tissue samples for expression analysis in disease states

  • Mouse models for in vivo functional studies

How should I interpret differences in COL4A3BP expression between normal and disease tissues?

When analyzing COL4A3BP expression differences:

  • Consider isoform expression ratios:

    • The ratio between GPBP and GPBPΔ26 may be more informative than total protein levels

    • Developmental stages show differential expression of these isoforms

  • Cellular localization changes:

    • Assess changes in subcellular distribution (cytoplasm, Golgi apparatus, ER)

    • Altered localization may indicate functional changes even without expression level differences

  • Correlation with ceramide metabolism:

    • Interpret COL4A3BP expression in context with ceramide levels and distribution

    • Disruption of nonvesicular ceramide transport can be detrimental to normal tissue function

  • Tissue-specific expression patterns:

    • In disease research, compare expression in relevant tissues (e.g., brain, kidney, thyroid)

    • Validated tissues for antibody studies include thyroid cancer, gastric cancer, pancreas, and kidney

  • Correlation with apoptosis markers:

    • Research in zebrafish showed COL4A3BP knockdown linked to increased apoptosis

    • Consider co-staining with apoptosis markers when analyzing diseased tissues

What is the significance of COL4A3BP phosphorylation and how can it be studied?

COL4A3BP phosphorylation has significant functional implications:

  • Regulatory mechanisms:

    • The serine-rich motif in CERT undergoes phosphorylation, which down-regulates the ER to Golgi transport of ceramide

    • This represents a key regulatory mechanism for ceramide trafficking

  • Methodological approaches for studying phosphorylation:

    • Phospho-specific antibodies (if available)

    • Mass spectrometry to identify phosphorylation sites

    • In vitro kinase assays to assess phosphorylation activity

    • Phosphomimetic and phospho-deficient mutants to study functional consequences

  • Functional significance:

    • Phosphorylation of COL4A3BP affects its ceramide transfer activity

    • COL4A3BP itself functions as a kinase that phosphorylates the Goodpasture antigen

    • Understanding this dual role as both kinase and phosphorylation target is critical for comprehensive functional studies

  • Disease relevance:

    • Altered phosphorylation states may contribute to pathological conditions

    • In Goodpasture disease, abnormal phosphorylation of collagen IV α3 chain may contribute to autoantigen formation

What are the key experimental considerations when studying COL4A3BP's role in ceramide transport?

When investigating COL4A3BP's function in ceramide transport:

Through careful experimental design addressing these considerations, researchers can effectively investigate COL4A3BP's critical role in ceramide homeostasis and related disease mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.