COL4A3BP antibody is a specialized immunoglobulin designed to recognize and bind to collagen type IV alpha-3 binding protein (COL4A3BP), also known as ceramide transfer protein (CERT) or START domain-containing protein 11 (STARD11). This antibody is predominantly produced in rabbit hosts as polyclonal immunoglobulins with demonstrated reactivity against human, mouse, and rat COL4A3BP protein . Commercial preparations typically feature affinity-purified formulations that provide high specificity and minimal cross-reactivity, making them valuable tools for detecting COL4A3BP expression in various experimental systems .
The antibody production process generally involves immunizing rabbits with specific immunogens such as synthetic peptides derived from human COL4A3BP protein sequences or recombinant protein fragments. For instance, some manufacturers utilize recombinant fusion proteins containing amino acid sequences corresponding to positions 369-598 of human COL4A3BP (NP_112729.1) . These carefully selected immunogenic regions ensure that the resulting antibodies exhibit optimal binding characteristics and specificity.
Commercial preparations of COL4A3BP antibodies are available from multiple manufacturers including Novus Biologicals (Bio-Techne), Assay Genie, Proteintech, ABClonal, Elabscience, and Atlas Antibodies, each offering slightly different formulations with varying specifications for research applications .
The COL4A3BP gene encodes a kinase that specifically phosphorylates the N-terminal region of the non-collagenous domain of the alpha 3 chain of type IV collagen, known as the Goodpasture antigen . The protein has a calculated molecular weight of approximately 71 kDa, though it is often observed at 80-89 kDa in gel electrophoresis due to post-translational modifications .
COL4A3BP protein functions as a ceramide transfer protein (hence its alternative name CERT) that extracts ceramide from the endoplasmic reticulum and transports it to the Golgi apparatus . This ceramide trafficking function is critical for sphingolipid metabolism and membrane biogenesis. The protein contains specific domains that facilitate its lipid transfer activities, including the StAR-related lipid transfer (START) domain, which is responsible for ceramide binding and transport .
COL4A3BP exhibits a distinctive cellular distribution pattern, predominantly localizing to the cytoplasm, Golgi apparatus, and endoplasmic reticulum . This localization pattern aligns with its functional role in ceramide transport between these organelles. The protein is preferentially concentrated in the Golgi apparatus, reflecting its central role in sphingolipid metabolism and vesicular transport .
Expression analyses using COL4A3BP antibodies have demonstrated the presence of this protein in various tissues including brain, pancreas, kidney, thyroid, and gastric tissues . In particular, strong expression has been documented in human pancreas and kidney tissues, as well as in mouse brain tissue .
COL4A3BP plays critical roles in diverse biological processes, including:
Ceramide intracellular transport and sphingolipid metabolism
Cell adhesion, migration, and signaling
Regulation of cell growth and survival
Notably, COL4A3BP has been implicated in Goodpasture disease, an autoimmune condition resulting from an immune response directed against the Goodpasture antigen (the alpha 3 chain of type IV collagen) . Additionally, recent research utilizing COL4A3BP antibodies has suggested potential roles for this protein in cancer biology, with studies examining its expression in thyroid and gastric cancer tissues .
COL4A3BP antibodies demonstrate specific reactivity against human, mouse, and rat samples, making them versatile tools for cross-species research applications . The antibodies recognize specific epitopes within the COL4A3BP protein, with various commercial products targeting different regions. For example, Atlas Antibodies' HPA035645 targets the PrEST antigen sequence "GEAITFKATTAGILATLSHCIELMVKREDSWQKRLDKETEKKRRTEEAYKNAMTELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALD" .
Validation studies performed by manufacturers have confirmed antibody specificity through techniques such as western blotting, immunohistochemistry, and immunofluorescence on verified sample types . Positive western blot detection has been reported in mouse brain tissue, HEK-293 cells, human pancreas tissue, mouse kidney tissue, mouse pancreas tissue, and rat brain tissue .
Commercial COL4A3BP antibodies are available in various formats, with most products offered as unconjugated polyclonal rabbit IgG antibodies . These antibodies are typically supplied as liquid formulations in storage buffers containing phosphate-buffered saline (PBS) with preservatives such as sodium azide (0.02-0.08%) and stabilizers like glycerol (40-50%) .
The concentration of antibody preparations varies between manufacturers, with some products providing concentration information on the vial label and others specifying typical concentrations (e.g., 0.4 mg/mL) . Most products are offered in volumes ranging from 20 μL to 100 μL, with some manufacturers providing multiple size options to accommodate different research needs .
COL4A3BP antibodies are predominantly produced through immunization of rabbits with carefully selected immunogens . The immunogens used include:
Following immunization and antibody production, the antibodies undergo purification processes to enhance specificity and reduce background interference. Affinity purification represents the standard method employed across manufacturers, using the target antigen as an affinity ligand to isolate specific antibodies from serum .
COL4A3BP antibodies are extensively validated for western blotting applications, with recommended dilutions typically ranging from 1:200 to 1:10,000 depending on the specific product and application conditions . Western blotting with these antibodies enables detection of COL4A3BP protein at its expected molecular weight of approximately 71-89 kDa .
Table 1: Recommended Western Blot Dilutions for Different COL4A3BP Antibodies
| Product | Manufacturer | Recommended WB Dilution | Observed MW |
|---|---|---|---|
| NBP3-30940 | Novus Biologicals | 1:400 | Not specified |
| CAB15376 | Assay Genie | 1:200 - 1:2000 | 71 kDa |
| 15191-1-AP | Proteintech | 1:2000 - 1:10000 | 80-89 kDa |
| A15376 | ABClonal | 1:200 - 1:2000 | 71 kDa |
| HPA035645 | Atlas Antibodies | 0.04-0.4 μg/ml | Not specified |
Studies utilizing these antibodies for western blotting have successfully detected COL4A3BP in various sample types, including mouse brain tissue, HEK-293 cells, human pancreas tissue, mouse kidney tissue, and rat brain tissue .
Immunohistochemical applications represent another important use for COL4A3BP antibodies, enabling the visualization of protein expression and localization in tissue sections . These antibodies have been validated for immunohistochemistry on human tissues including pancreas, kidney, thyroid cancer, and gastric cancer samples .
For optimal immunohistochemical staining, manufacturers recommend dilutions ranging from 1:50 to 1:500, with specific protocols often suggesting antigen retrieval methods such as heat-induced epitope retrieval (HIER) with either citrate buffer (pH 6.0) or TE buffer (pH 9.0) .
COL4A3BP antibodies are also applicable for immunofluorescence and immunocytochemistry protocols, allowing for detailed subcellular localization studies . These applications have successfully visualized COL4A3BP in cell lines such as L929 cells with recommended dilutions typically ranging from 1:50 to 1:200 .
Atlas Antibodies' HPA035645, for instance, recommends PFA/Triton X-100 fixation/permeabilization protocols with working concentrations of 0.25-2 μg/ml for optimal immunofluorescence results .
Some COL4A3BP antibodies have been validated for immunoprecipitation applications, demonstrating the ability to pull down the target protein from complex biological samples . For example, Proteintech's 15191-1-AP has been validated for immunoprecipitation from mouse brain tissue with recommended usage of 0.5-4.0 μg antibody per 1.0-3.0 mg of total protein lysate .
COL4A3BP (now also referred to as CERT1) encodes a kinase that specifically phosphorylates the N-terminal region of the non-collagenous domain of the alpha 3 chain of type IV collagen, known as the Goodpasture antigen . This protein has dual functions: as a kinase involved in phosphorylation events and as a ceramide transfer protein that mediates intracellular trafficking of ceramides in a non-vesicular manner . It is particularly important in research related to autoimmune conditions (as Goodpasture disease results from an autoimmune response directed at this antigen), lipid metabolism, and cellular signaling pathways .
The COL4A3BP gene is alternatively spliced, producing multiple protein isoforms with different functional properties:
GPBP (full-length variant) - Contains a serine-rich domain of 26 amino acid residues
GPBPΔ26 (shorter variant) - Lacks the serine-rich domain encoded by exon 11
These isoforms exhibit different binding capacities to the Goodpasture auto-antigen and different kinase activities. The full-length GPBP shows stronger binding and kinase activity compared to GPBPΔ26 . Both isoforms function as ceramide transfer proteins (CERT), but they are differentially expressed during development and may have distinct biological roles .
COL4A3BP is predominantly located in the cytoplasm, with preferential localization to the Golgi apparatus. It is also found in the endoplasmic reticulum . The protein contains domain structures that facilitate this localization:
An amino-terminal pleckstrin homology (PH) domain
A middle FFAT motif (two phenylalanines in acidic tract)
A carboxyl-terminal START domain
The PH domain permits localization to the Golgi apparatus, while the FFAT domain allows association with the endoplasmic reticulum, enabling the protein to transfer ceramides between these organelles .
Based on the available data, COL4A3BP antibodies are validated for the following applications:
| Application | Validated in Sources | Common Dilutions |
|---|---|---|
| Western Blot (WB) | Human, mouse, rat tissues | 1:2000-1:10000 |
| Immunohistochemistry (IHC) | Human thyroid cancer, gastric cancer, pancreas, kidney | 1:50-1:500 |
| Immunoprecipitation (IP) | Mouse brain tissue | 0.5-4.0 μg for 1.0-3.0 mg lysate |
| Immunofluorescence (IF) | Cell lines (e.g., L929) | 1:50-1:200 |
| ELISA | Various | As specified by protocol |
The selection of application should be based on the specific research question and experimental system .
For optimal IHC staining using COL4A3BP antibodies, consider the following methodological recommendations:
Antigen retrieval: Use TE buffer at pH 9.0 as the primary method; alternatively, citrate buffer at pH 6.0 can be used .
Dilution range: Begin with 1:50-1:200 dilution for polyclonal antibodies and adjust based on signal strength .
Verified samples: Human thyroid cancer, human gastric cancer, human pancreas, and human kidney tissues have been successfully used for IHC validation .
Blocking: Use 5% Milk-TBST for blocking and as antibody diluent for consistent results .
Incubation: For optimal binding, incubate primary antibody overnight at 4°C .
Always perform antibody titration in your specific testing system to obtain optimal results, as sensitivity may be sample-dependent .
For Western blot applications with COL4A3BP antibodies:
Sample preparation: Multiple tissue types have yielded positive results including mouse brain, HEK-293 cells, human pancreas, mouse kidney, and rat brain tissues .
Dilution range: Use 1:2000-1:10000 for primary antibody incubation .
Blocking conditions: 5% Milk-TBST is recommended for blocking and as antibody diluent .
Primary antibody incubation: Incubate overnight at 4°C for optimal results .
Expected molecular weight: The calculated molecular weight of COL4A3BP is 71 kDa, but the observed molecular weight in Western blots typically ranges from 80-89 kDa, likely due to post-translational modifications .
Secondary antibody: For rabbit-hosted COL4A3BP antibodies, use anti-rabbit IgG with appropriate conjugation (HRP is common) .
If experiencing weak or no signal with COL4A3BP antibodies, consider these approaches:
Antibody dilution: Decrease the dilution factor (use more concentrated antibody) within the recommended range (e.g., start with 1:50 for IHC or 1:2000 for WB) .
Antigen retrieval: Ensure proper antigen retrieval by testing both recommended methods (TE buffer pH 9.0 and citrate buffer pH 6.0) .
Incubation time: Extend the primary antibody incubation time to overnight at 4°C .
Sample preparation: Verify protein expression in your specific sample type; consult the list of verified positive samples (mouse brain, HEK-293 cells, human pancreas tissue, etc.) .
Storage conditions: Ensure the antibody has been properly stored at -20°C and has not undergone multiple freeze-thaw cycles .
Verify antibody viability: Use a known positive control sample where COL4A3BP expression has been confirmed .
The choice between polyclonal and monoclonal antibodies should be guided by your specific research needs:
Polyclonal antibodies (like E-AB-14885, 15191-1-AP):
Recognize multiple epitopes on COL4A3BP, potentially increasing sensitivity
Useful for detecting low-abundance proteins or denatured proteins
Show broader species cross-reactivity (often reactive with human, mouse, and rat)
May have higher background in some applications
Monoclonal antibodies:
Recognize a single epitope, providing higher specificity
More consistent lot-to-lot with less background variation
Potentially lower sensitivity for detecting native proteins
May have more restricted species reactivity
For COL4A3BP research requiring detection of specific isoforms, consider the immunogen location relative to the alternative splicing region (exon 11). Many available antibodies are raised against recombinant proteins or N-terminal regions (residues 1-50), which may detect both GPBP and GPBPΔ26 isoforms .
High background in IHC can interfere with specific signal detection. To minimize background when using COL4A3BP antibodies:
Optimize blocking: Use 5% Milk-TBST or add 0.1% BSA to the blocking buffer as done in some validated protocols .
Antibody dilution: Use the highest dilution that still produces specific signal (e.g., 1:200 for IHC) .
Washing steps: Increase the number and duration of washes between antibody incubations.
Secondary antibody optimization: Ensure secondary antibody is properly diluted and has minimal cross-reactivity with the sample species.
Endogenous peroxidase quenching: For HRP-based detection systems, adequately quench endogenous peroxidase activity.
Evaluate fixation: Overfixation can increase background; test different fixation protocols if possible.
Test antibody specificity: Consider validating antibody specificity using knockout or knockdown controls .
Distinguishing between GPBP and GPBPΔ26 isoforms requires specific methodological approaches:
PCR-based detection:
Immunoblotting:
Specific antibodies:
Functional assays:
Several effective genetic manipulation strategies have been used to study COL4A3BP function:
CRISPR-Cas9 knockout:
Splice-blocking morpholinos:
5'UTR-targeting morpholinos:
Rescue experiments:
The phenotypes associated with COL4A3BP knockdown in zebrafish included increased apoptosis in somites, brain edema, and loss of myelinated tracks, suggesting important roles in normal skeletal muscle and brain development .
COL4A3BP has been implicated in several disease contexts:
Autoimmune diseases:
Developmental disorders:
Pulmonary vascular disease:
Cancer research:
Appropriate research models include:
Zebrafish for developmental studies (allows isoform-specific manipulation)
Cell culture models for ceramide transport and Golgi-ER trafficking studies
Human tissue samples for expression analysis in disease states
When analyzing COL4A3BP expression differences:
Consider isoform expression ratios:
Cellular localization changes:
Correlation with ceramide metabolism:
Tissue-specific expression patterns:
Correlation with apoptosis markers:
COL4A3BP phosphorylation has significant functional implications:
Regulatory mechanisms:
Methodological approaches for studying phosphorylation:
Phospho-specific antibodies (if available)
Mass spectrometry to identify phosphorylation sites
In vitro kinase assays to assess phosphorylation activity
Phosphomimetic and phospho-deficient mutants to study functional consequences
Functional significance:
Disease relevance:
When investigating COL4A3BP's function in ceramide transport:
Through careful experimental design addressing these considerations, researchers can effectively investigate COL4A3BP's critical role in ceramide homeostasis and related disease mechanisms.