Target: COX6C (cytochrome c oxidase subunit VIc) is a 75-amino-acid protein with a molecular weight of ~9 kDa .
Antibody Types: Polyclonal antibodies (e.g., Proteintech 11429-2-AP) and monoclonal antibodies (e.g., Abcam EPR9938) .
Immunogen: Commonly derived from fusion proteins or synthetic peptides, such as the sequence MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVK .
COX6 antibodies are utilized in diverse experimental workflows:
WB Validation: Distinct bands at ~9 kDa in human fetal heart, HepG2, and A-673 cell lines .
IHC Localization: Strong staining in pancreatic and breast carcinoma tissues .
COX6 interacts with Atp9 to form Atco complexes, which are essential for COX and ATP synthase assembly in Saccharomyces cerevisiae. Allotopic expression of COX6 in mitochondria revealed that only a small fraction integrates into Atco, suggesting its role as a rate-limiting factor in COX biogenesis .
Key Insight: Mitochondrial COX6 expression results in respiratory deficiency due to impaired COX assembly, as shown by reduced cytochrome oxidase levels and free bc1 complexes .
Cancer: COX6C overexpression driven by 8q22.2 amplification promotes lung adenocarcinoma (LUAD) proliferation. Knockdown of COX6C induces mitochondrial dysfunction, ROS accumulation, and apoptosis via AMPK pathway activation .
Prostate Cancer: COX6C is upregulated in prostate cancer cells, correlating with tumor progression .
KEGG: sce:YHR051W
STRING: 4932.YHR051W
COX6C (Cytochrome c oxidase subunit 6C) is one of the nuclear-encoded polypeptide chains of cytochrome c oxidase, which serves as the terminal oxidase in the mitochondrial respiratory chain . This enzyme is composed of 13 different subunits and catalyzes the electron transfer from reduced cytochrome c to oxygen . COX6C is specifically located in the mitochondrion inner membrane as a single-pass membrane protein . Functionally, it is integral to the electron transport chain and cellular respiration, playing a crucial role in ATP production through oxidative phosphorylation.
The protein has a calculated molecular weight of approximately 9 kDa and consists of 75 amino acids . Understanding COX6C is important as it represents a key component in cellular energy metabolism, and alterations in its expression or function can have significant implications for mitochondrial function and cellular homeostasis.
COX6C antibodies are utilized across multiple experimental applications, with the most common being:
| Application | Typical Dilution Ranges | Common Sample Types |
|---|---|---|
| Western Blot (WB) | 1:500-1:2000 | Human heart tissue, cell lysates |
| Immunohistochemistry (IHC) | 1:20-1:300 | Human pancreas cancer tissue, LUAD samples |
| Immunofluorescence (IF) | 1:200-1:1000 | Cell lines (e.g., HepG2) |
| ELISA | 1:20000 | Various protein preparations |
For Western blot applications, COX6C antibodies typically detect a band at approximately 9 kDa, though some antibodies may detect bands at different molecular weights (e.g., 32 kDa) depending on the specific epitope and potential post-translational modifications . When using these antibodies, researchers should verify reactivity with their species of interest, as most commercial antibodies show reactivity with human, mouse, and rat samples .
For optimal preservation of antibody activity, COX6C antibodies should be stored at -20°C, where they typically remain stable for up to one year . Most commercial preparations are supplied in liquid form in PBS containing 50% glycerol, 0.5% BSA, and 0.02% sodium azide as a preservative .
When working with these antibodies:
Avoid repeated freeze-thaw cycles which can compromise antibody function
For the 11429-2-AP antibody specifically, aliquoting is unnecessary for -20°C storage
Allow antibodies to reach room temperature before opening the vial
Briefly centrifuge before use to collect contents at the bottom of the tube
When diluting, use fresh, sterile buffers and avoid contamination
Proper storage and handling not only extends the shelf-life of the antibody but also ensures consistent experimental results across multiple studies.
The optimal antigen retrieval methods for COX6C immunohistochemistry depend on the specific tissue type and fixation method employed. Based on available data:
For human pancreatic cancer tissues, the suggested antigen retrieval involves TE buffer at pH 9.0 . Alternatively, citrate buffer at pH 6.0 can be used if TE buffer produces suboptimal results . The specific protocol typically involves:
Deparaffinization and rehydration of tissue sections
Heat-induced epitope retrieval (HIER) using TE buffer (pH 9.0) or citrate buffer (pH 6.0)
Cooling to room temperature gradually
Blocking of endogenous peroxidases with hydrogen peroxide
Protein blocking to reduce background staining
Incubation with primary COX6C antibody at dilutions ranging from 1:20 to 1:200
For lung adenocarcinoma (LUAD) tissues, similar antigen retrieval methods have been employed successfully in tissue microarray (TMA) analysis . Researchers should note that optimization may be required for each specific tissue type and antibody combination, and preliminary experiments to determine the most effective antigen retrieval method are advised.
Non-specific binding is a common challenge when using COX6C antibodies in Western blot applications. To troubleshoot this issue, researchers can implement the following methodological approaches:
Optimize antibody concentration: Titrate antibody dilutions (e.g., 1:500, 1:750, 1:1000) to identify the optimal concentration that provides specific signal with minimal background .
Adjust blocking conditions: Increase blocking time or modify blocking reagent composition. For COX6C antibodies, 5% non-fat dry milk or 3-5% BSA in TBST are commonly effective.
Increase washing stringency: Additional or longer washing steps with TBST (Tris-buffered saline with 0.1% Tween-20) can reduce non-specific signals.
Use positive and negative controls:
Verify molecular weight: Confirm that detected bands align with the expected molecular weight of 9 kDa for COX6C . Divergent bands at significantly different sizes may represent non-specific binding or post-translational modifications.
Consider sample preparation: Ensure complete protein denaturation and proper reduction of disulfide bonds. For mitochondrial proteins like COX6C, specialized extraction protocols may yield better results.
Validate with alternate antibodies: If possible, confirm results using different COX6C antibodies targeting distinct epitopes to rule out antibody-specific artifacts.
By systematically implementing these approaches, researchers can significantly improve the specificity of COX6C detection in Western blot experiments.
To rigorously validate COX6C antibody specificity, researchers should implement multiple control strategies:
Positive expression controls:
Negative controls:
Peptide competition assays:
Pre-incubate the COX6C antibody with the immunizing peptide (for antibodies raised against synthetic peptides)
Signal elimination or reduction confirms binding specificity
Cross-validation with multiple detection methods:
Confirm protein expression using orthogonal techniques (e.g., mass spectrometry)
Compare results from multiple antibodies targeting different epitopes of COX6C
Correlate protein detection with mRNA expression data
Species reactivity validation:
Application-specific controls:
For IHC: Include normal adjacent tissue as internal control
For IF: Include subcellular localization controls (mitochondrial markers)
For WB: Include molecular weight markers and loading controls
Proper validation not only ensures experimental rigor but also enhances reproducibility and reliability of research findings involving COX6C.
COX6C antibodies can be powerful tools for investigating mitochondrial assembly and function through several sophisticated experimental approaches:
Analysis of Cytochrome c Oxidase Assembly Intermediates:
COX6C antibodies can be used in immunoprecipitation experiments to isolate and characterize assembly intermediates of cytochrome c oxidase
When combined with pulse-chase labeling techniques, researchers can track the incorporation of COX6C into the enzyme complex over time
This approach has revealed that COX6C is a component of the Cox1 assembly module, providing insights into the step-wise assembly process of COX
Investigation of Mitochondrial Supercomplexes:
Blue Native PAGE (BN-PAGE) combined with COX6C immunoblotting allows visualization of respiratory chain supercomplexes
This technique can reveal how mutations or environmental factors affect the integration of COX into higher-order structures
Studies have shown that altered COX6C expression can impact the formation of supercomplexes, affecting respiratory efficiency
Mitochondrial Proteomics and Interactome Analysis:
COX6C antibodies enable the identification of novel protein-protein interactions through techniques like proximity labeling or co-immunoprecipitation
Research has identified interactions between COX6C and Atp9 (a component of ATP synthase) in complexes called Atco, which function in the biogenesis of both cytochrome oxidase and ATP synthase
Functional Consequences of COX6C Alterations:
These methodologies provide researchers with powerful means to unravel the complex roles of COX6C in mitochondrial biogenesis, assembly, and function.
Antibody-based studies have provided significant insights into COX6C's emerging role in cancer biology:
Altered Expression in Multiple Cancer Types:
Genomic Amplification Driving COX6C Overexpression:
Functional Impact on Cancer Cell Phenotypes:
Tissue Microarray (TMA) Studies:
Large-scale immunohistochemical analyses using COX6C antibodies on tissue microarrays containing paired tumor and normal tissues from 145 LUAD patients have provided crucial data on expression patterns and clinical correlations
Such studies help establish the potential diagnostic and prognostic value of COX6C in cancer
Potential Therapeutic Implications:
By utilizing COX6C antibodies to monitor protein levels, researchers can assess the effects of various therapeutic interventions that target mitochondrial function in cancer cells
This approach helps identify tumors that might be particularly vulnerable to metabolism-targeting therapies
These findings collectively suggest that COX6C may play more complex roles beyond its canonical function in oxidative phosphorylation, potentially contributing to cancer development and progression.
Researchers occasionally encounter discrepancies in the detected molecular weight of COX6C, which can cause confusion and interpretive challenges. The observed molecular weight can vary from the expected 9 kDa to approximately 32 kDa in different studies. These discrepancies can be methodically analyzed using the following framework:
Protein Characteristics and Post-translational Modifications:
While the calculated molecular weight of COX6C is 9 kDa (75 amino acids) , post-translational modifications can significantly alter migration patterns
Phosphorylation, glycosylation, ubiquitination, or SUMOylation may explain higher molecular weight observations
Researchers should consider using phosphatase treatment or other modification-specific enzymes to evaluate this possibility
Antibody Epitope Considerations:
Different antibodies target distinct epitopes of COX6C:
Epitope location can affect detection of different isoforms or modified variants
Sample Preparation Influences:
Protein extraction methods significantly impact observed molecular weights:
Harsh detergents may dissociate protein complexes
Different extraction buffers may preserve or disrupt post-translational modifications
For mitochondrial proteins like COX6C, specialized extraction methods may yield different results
Technical Considerations:
Gel percentage and running conditions affect migration patterns
Gel systems (Tris-glycine vs. Tris-tricine) have different resolving capabilities for low molecular weight proteins
Calibration standards and reference proteins influence apparent molecular weight calculations
Biological Variables:
Different cell/tissue types may express distinct COX6C isoforms
Disease states (e.g., cancer) may alter COX6C processing or modification
In mitochondrial studies, the observed 32 kDa band might represent COX6C in a stable complex with interacting partners
When encountering such discrepancies, researchers should:
Report all observed bands with their molecular weights
Validate findings with multiple antibodies targeting different epitopes
Use mass spectrometry for definitive protein identification
Consider performing 2D gel electrophoresis to separate proteins by both isoelectric point and molecular weight
These comprehensive approaches help resolve ambiguities and enhance the reliability of COX6C detection in experimental settings.
Research has identified important interactions between COX6C and Atp9 (a component of ATP synthase) in complexes called Atco, which function in the biogenesis of both cytochrome oxidase and ATP synthase. Several sophisticated methodologies are available for investigating these interactions:
In Organello Radiolabeling for Assembly Kinetics:
Pulse-labeling mitochondria with 35S-methionine/cysteine enables tracking of newly synthesized COX6C
This approach revealed that only a fraction of newly translated Cox6 is present in Atco complexes
The technique provides temporal resolution of complex assembly not achievable with steady-state measurements
Allotopic Expression Systems:
Relocation of COX6C from the nuclear to the mitochondrial genome (as demonstrated with the COX6-C construct) offers a unique system to study assembly dynamics
This experimental system revealed that mitochondrially encoded COX6C can still form complexes with Atp9, confirming the fundamental nature of this interaction regardless of the source of COX6C
Affinity Purification Coupled with Mass Spectrometry:
Blue Native PAGE for Intact Complex Analysis:
Genetic Approaches to Investigate Functional Significance:
These methodologies collectively provide powerful means to dissect the stoichiometry, dynamics, and functional significance of COX6C-Atp9 interactions in mitochondrial biogenesis.
The relationship between COX6C copy number amplification (particularly at chromosome 8q22.2) and protein expression in cancer represents an important research area. Several methodological approaches can be employed to investigate this relationship:
Integrated Genomic and Proteomic Analysis:
Tissue Microarray (TMA) Analysis:
Functional Validation Through Genetic Manipulation:
CRISPR-based approaches to create isogenic cell lines with different COX6C copy numbers
shRNA knockdown or overexpression systems to modulate COX6C levels
Western blot and functional assays to assess consequences of altered expression
Multi-level Expression Analysis:
qRT-PCR for mRNA quantification
Western blotting for protein levels
Assessment of whether genomic amplification translates to proportional increases at mRNA and protein levels
Clinical Correlation Studies:
Analysis of patient survival data in relation to both COX6C copy number and protein expression
Investigation of associations with clinical parameters (tumor stage, grade, treatment response)
Multivariate analyses to determine independent prognostic value
Mechanistic Studies on Amplification-Driven Phenotypes:
These approaches provide a comprehensive framework for understanding how genomic alterations in COX6C translate to functional consequences at the protein level and ultimately affect cancer biology.
Detecting COX6C in different cellular compartments using immunofluorescence (IF) presents several technical challenges that researchers must address for accurate localization studies:
Preserving Mitochondrial Morphology and Epitope Accessibility:
COX6C is located in the mitochondrial inner membrane , making epitope accessibility challenging
Fixation methods critically impact mitochondrial morphology and antibody penetration:
Paraformaldehyde (4%) preserves structure but may reduce epitope accessibility
Methanol fixation improves permeabilization but can distort mitochondrial morphology
Combined protocols with brief PFA fixation followed by methanol permeabilization often yield optimal results
Signal-to-Noise Ratio Optimization:
The relatively low abundance of COX6C requires careful optimization of antibody dilutions (typically 1:200-1:1000)
Background fluorescence from non-specific binding necessitates extensive blocking:
Extended blocking periods (1-2 hours) with 5-10% normal serum
Addition of 0.1-0.3% Triton X-100 for improved permeabilization
BSA (3-5%) to reduce non-specific antibody binding
Multi-label Strategies for Accurate Localization:
Co-staining with established mitochondrial markers is essential:
MitoTracker dyes for live-cell mitochondrial labeling
Tom20 or VDAC antibodies for mitochondrial outer membrane
Prohibitin or Tim23 for inner membrane markers
Careful selection of secondary antibodies to avoid spectral overlap
Distinguishing Functional Pools of COX6C:
COX6C exists in multiple functional states (free protein, Atco complexes, and mature COX)
Standard IF cannot readily distinguish between these pools
Advanced techniques required:
Proximity ligation assay (PLA) to detect specific interactions
FRET-based approaches for protein proximity detection
Super-resolution microscopy to resolve suborganellar locations
Technical Considerations for Imaging:
The small size of mitochondria (typically 0.5-1μm in diameter) necessitates high-resolution imaging
Deconvolution or super-resolution techniques (STED, STORM, PALM) significantly improve visualization
Z-stack acquisition essential for accurate 3D localization
Quantitative image analysis algorithms needed for objective assessment
Validation Strategies:
Controls for antibody specificity (peptide competition, COX6C knockdown cells)
Subcellular fractionation with Western blot validation
Correlation with functional assays (respiratory capacity measurements)
Addressing these challenges systematically enables more reliable detection and localization of COX6C, advancing our understanding of its roles in different cellular compartments and conditions.
Emerging single-cell technologies offer unprecedented opportunities to investigate COX6C heterogeneity across individual cells within complex tissues, potentially revealing functional diversity not apparent in bulk analyses:
Single-Cell Immunofluorescence Technologies:
Multiplex immunofluorescence combined with COX6C antibodies enables visualization of expression heterogeneity while preserving spatial context
Imaging mass cytometry (IMC) allows simultaneous detection of multiple proteins including COX6C at single-cell resolution
Spatial transcriptomics coupled with protein detection can correlate COX6C protein levels with gene expression patterns in situ
Flow Cytometry and Mass Cytometry Applications:
Intracellular staining protocols optimized for COX6C detection enable quantification across large cell populations
Mass cytometry (CyTOF) allows measurement of COX6C alongside dozens of other markers without spectral overlap concerns
Cell sorting based on COX6C levels followed by functional assays can reveal phenotypic consequences of expression variability
Single-Cell Proteomics Approaches:
Recent advances in single-cell proteomics make it feasible to quantify COX6C at the individual cell level
Integration with mitochondrial functional parameters can reveal correlations between COX6C levels and respiratory capacity
Development of nanobody-based detection systems may improve sensitivity for low-abundance mitochondrial proteins like COX6C
Computational Analysis of Heterogeneity:
Machine learning algorithms can identify distinct cell subpopulations based on COX6C expression patterns
Trajectory inference methods may reveal dynamic changes in COX6C expression during cellular processes
Network analysis can position COX6C within cell-type-specific protein interaction networks
Clinical and Translational Applications:
Analysis of COX6C heterogeneity in patient samples may reveal clinically relevant subpopulations
In cancer tissues, spatial mapping of cells with chromosomal 8q22.2 amplification and corresponding COX6C protein levels could identify tumor regions with distinct metabolic properties
Single-cell multiomics approaches integrating genomic, transcriptomic, and proteomic data may uncover regulatory mechanisms driving COX6C heterogeneity
These emerging technologies promise to transform our understanding of COX6C biology by revealing cell-to-cell variability that may have important functional and clinical implications.
The emerging role of COX6C in cancer biology, particularly its amplification in lung adenocarcinoma and other cancers , presents several avenues for therapeutic development. Future research directions may include:
Direct Inhibition Strategies:
Development of small molecule inhibitors specifically targeting COX6C
Peptide-based approaches to disrupt COX6C interactions with other components of the respiratory chain
Evaluation of natural compounds that selectively modulate COX6C function
Exploiting Metabolic Vulnerabilities:
Cancer cells with COX6C amplification may exhibit altered metabolic dependencies
Synthetic lethality approaches combining COX6C targeting with inhibitors of compensatory metabolic pathways
Metabolic profiling to identify unique vulnerabilities in tumors with high COX6C expression
Genomic and Epigenetic Targeting:
CRISPR-based approaches to specifically target amplified COX6C loci
Epigenetic modifiers to regulate COX6C expression
Antisense oligonucleotides or siRNA-based therapeutics to reduce COX6C levels
Immunotherapeutic Approaches:
Exploration of COX6C as a potential tumor-associated antigen for immunotherapy
Development of antibody-drug conjugates targeting surface-exposed mitochondrial proteins in cancer cells with altered mitochondrial dynamics
Evaluation of whether metabolic alterations associated with COX6C amplification affect tumor immunogenicity
Combination Therapy Strategies:
Identification of synergistic combinations of COX6C-targeted therapies with conventional chemotherapeutics
Investigation of whether COX6C inhibition sensitizes tumors to radiation therapy
Exploration of combinations with other mitochondria-targeting agents
Biomarker Development:
Validation of COX6C amplification or protein overexpression as predictive biomarkers for response to metabolism-targeting therapies
Development of companion diagnostics using COX6C antibodies for patient stratification
Longitudinal assessment of COX6C as a marker of treatment response
These research directions highlight the potential therapeutic significance of COX6C in cancer treatment, particularly for tumors characterized by 8q22.2 amplification. The development of COX6C antibodies with improved specificity will be crucial for advancing these therapeutic strategies and companion diagnostics.
Recent advances in cryo-electron microscopy (cryo-EM) offer transformative opportunities for elucidating COX6C structure-function relationships at unprecedented resolution, potentially revolutionizing our understanding of this protein's role in mitochondrial function and disease:
High-Resolution Structural Analysis:
Cryo-EM can now achieve near-atomic resolution of membrane protein complexes like cytochrome c oxidase
This enables precise mapping of COX6C's position within the holoenzyme
Structural information can reveal how COX6C contributes to enzyme stability, assembly, and function
Visualization of Dynamic Assembly Intermediates:
Time-resolved cryo-EM approaches can capture various assembly states of cytochrome c oxidase
This could reveal the temporal sequence of COX6C incorporation during complex formation
Visualization of Atco complexes containing both COX6C and Atp9 would provide crucial insights into their structural relationship
Conformational Dynamics and Functional States:
Modern cryo-EM methods can resolve multiple conformational states within a single sample
This capability could reveal how COX6C participates in conformational changes during electron transfer
Computational approaches like 3D variability analysis can map the conformational landscape of cytochrome c oxidase
Structure-Guided Antibody Development:
High-resolution structures enable epitope mapping of existing COX6C antibodies
This information can guide the development of next-generation antibodies with improved specificity
Structure-based design of conformation-specific antibodies could distinguish between different functional states of COX6C
Pathogenic Variant Analysis:
Cryo-EM structures can provide a framework for interpreting the impact of disease-associated variants
Mutations affecting COX6C structure, stability, or interactions can be modeled based on high-resolution data
This structural context is essential for understanding how genetic alterations impact protein function
Drug Discovery Applications:
Atomic-resolution structures enable structure-based drug design targeting COX6C or its interactions
Virtual screening against structural pockets can identify small molecules that modulate COX6C function
Fragment-based approaches guided by structural data could lead to novel therapeutic candidates
In Situ Structural Biology:
Cryo-electron tomography (cryo-ET) allows visualization of macromolecular complexes in their native cellular environment
This approach could reveal how COX6C-containing complexes are organized within the mitochondrial inner membrane
Correlative light and electron microscopy (CLEM) combined with COX6C antibodies can provide functional context to structural data
These advanced structural biology approaches promise to bridge the gap between molecular structure and biological function, potentially leading to new therapeutic strategies targeting COX6C in various disease contexts.