col27a1a Antibody

What is COL27A1 and what biological systems express this protein?

COL27A1 (Collagen Type XXVII, alpha 1) is a member of the fibrillar collagen family that forms major structural elements in extracellular matrices. It is one of the most ancient families of extracellular matrix molecules and plays important roles in the structural integrity of cartilage, skin, and tendon tissues . Based on the available reactivity data, COL27A1 is conserved across multiple species with high sequence homology among mammals (Human: 100%; Dog, Horse, Pig, Bovine: 86%; Rat, Mouse: 85%) and even shows significant conservation in zebrafish (85%) . This high degree of conservation suggests important evolutionary functions of this collagen type.

What types of COL27A1 antibodies are available for research use?

The primary type of COL27A1 antibody currently available for research is rabbit polyclonal antibodies. These antibodies are generated using synthetic peptides directed towards the middle region of human COL27A1 as immunogens . The immunogen sequence typically used is: "LPGPKGDKGSRGDWGLQGPRGPPGPRGRPGPPGPPGGPIQLQQDDLGAAF" . These polyclonal antibodies are typically unconjugated (not linked to any reporter molecules) and are affinity-purified to enhance specificity .

What applications are COL27A1 antibodies validated for?

COL27A1 antibodies have been primarily validated for Western Blotting (WB) applications . Some antibodies may also be validated for immunohistochemistry (IHC) applications, with positive detection reported in human placenta tissue . The recommended dilutions typically range from 1:500 to 1:1000 for Western blotting and 1:50 to 1:500 for immunohistochemistry applications . It is important to empirically determine the optimal dilution for each specific experimental context as sensitivity can vary between different tissue and cell types.

How should I design a Western blot experiment to detect COL27A1 protein?

When designing a Western blot experiment to detect COL27A1:

• Sample preparation: Prepare whole cell lysates or tissue extracts from relevant sources (e.g., HeLa cells, HepG2 cells, brain or heart tissue) . Use a lysis buffer containing protease inhibitors to prevent degradation.

• Protein loading: Load 20-50 μg of total protein per lane. COL27A1 has a predicted protein size of approximately 90 kDa , although the actual observed size may vary due to post-translational modifications.

• Separation and transfer: Use 8-10% SDS-PAGE gels for optimal separation of high molecular weight proteins. Transfer proteins to PVDF or nitrocellulose membranes using standard protocols.

• Blocking and antibody incubation: Block membranes with 5% non-fat milk or BSA in TBST. Incubate with COL27A1 primary antibody at a 1:500-1:1000 dilution overnight at 4°C .

• Detection: Use compatible secondary antibodies (anti-rabbit IgG) conjugated to HRP, and visualize using chemiluminescence detection systems.

• Controls: Include positive controls such as HeLa or HepG2 cell lysates which have shown detectable levels of endogenous COL27A1 .

What protocols should I follow for IHC detection of COL27A1 in tissue samples?

For successful immunohistochemical detection of COL27A1:

• Tissue preparation: Fix tissues in 4% paraformaldehyde or formalin and embed in paraffin. Section tissues at 4-6 μm thickness.

• Antigen retrieval: Perform antigen retrieval using TE buffer at pH 9.0 (primary recommendation) or alternatively, citrate buffer at pH 6.0 . Heat treatment in these buffers (e.g., 95-100°C for 15-20 minutes) is crucial for exposing the epitopes.

• Blocking and antibody incubation: Block endogenous peroxidase activity with H₂O₂ and non-specific binding with serum. Incubate sections with primary antibody at dilutions ranging from 1:50 to 1:500 . Optimize dilution based on signal-to-noise ratio.

• Detection: Use appropriate detection systems such as HRP-polymer or avidin-biotin complex methods, followed by DAB (3,3'-diaminobenzidine) visualization.

• Positive tissue control: Use human placenta tissue as a positive control as it has been confirmed to express detectable levels of COL27A1 .

• Counterstaining: Counterstain with hematoxylin to visualize tissue architecture.

How can I troubleshoot weak or absent signal in Western blot when using COL27A1 antibody?

When confronting weak or absent signals in Western blots:

• Antibody concentration: Increase primary antibody concentration to 1:250-1:500 if the recommended 1:1000 dilution yields weak signals.

• Protein loading: Increase total protein amount loaded (up to 75-100 μg) if expression levels are low in your samples.

• Enhanced detection: Use high-sensitivity ECL substrates or signal amplification systems for low-abundance proteins.

• Protein extraction optimization: Ensure your lysis buffer effectively extracts collagen proteins by including detergents like 1% Triton X-100 or NP-40, along with protease inhibitors.

• Membrane selection: PVDF membranes may provide better protein retention than nitrocellulose for some antibodies.

• Extended exposure times: Increase exposure times during imaging to detect weak signals, while monitoring background levels.

• Alternative sample processing: Consider non-reducing conditions if reducing agents potentially disrupt epitope recognition.

• Fresh antibody: Antibody activity may diminish with repeated freeze-thaw cycles; use fresh aliquots if possible .

What are the optimal antigen retrieval conditions for COL27A1 immunohistochemistry?

For optimal antigen retrieval in COL27A1 immunohistochemistry:

• Primary recommendation: Use TE buffer (10 mM Tris, 1 mM EDTA) at pH 9.0 . This alkaline pH has been specifically recommended for COL27A1 antibody staining and often provides superior epitope unmasking for many antibodies targeting extracellular matrix proteins.

• Alternative method: If results are suboptimal, try citrate buffer at pH 6.0 as an alternative .

• Heating method optimization: Compare different heating methods for antigen retrieval:

  • Microwave: 3 × 5 minutes at 600W with cooling periods between

  • Pressure cooker: 2-3 minutes at full pressure

  • Water bath: 30-40 minutes at 95-100°C

• Duration testing: Optimize retrieval duration by testing different time points (10, 20, 30 minutes) to find the balance between sufficient epitope unmasking and tissue preservation.

• Cooling period: Allow slides to cool gradually to room temperature (15-20 minutes) before proceeding with staining to prevent tissue detachment and reduce background.

• Tissue-specific adjustments: Different tissue types may require modifications to retrieval conditions; cartilage and dense connective tissues often need extended retrieval times.

How can COL27A1 antibodies be used to investigate extracellular matrix (ECM) remodeling in disease models?

COL27A1 antibodies can provide valuable insights into ECM remodeling processes:

• Comparative tissue analysis: Using immunohistochemistry, compare COL27A1 expression and localization between normal and pathological tissues (e.g., normal versus fibrotic tissue) . Quantify staining intensity and pattern changes using digital image analysis software.

• Co-localization studies: Perform dual immunofluorescence staining with COL27A1 antibody and other ECM markers (fibronectin, elastin, matrix metalloproteinases) to identify spatial relationships and potential functional interactions.

• Temporal expression analysis: In disease progression models, collect samples at different time points to track changes in COL27A1 expression. Western blot analysis using standardized loading controls allows for quantitative comparison across time points .

• Cell-ECM interaction studies: Combine COL27A1 staining with cell type-specific markers to investigate cell-matrix relationships in development or pathology.

• 3D culture models: Evaluate COL27A1 deposition in 3D cell culture systems that better recapitulate tissue architecture using confocal microscopy and immunofluorescence.

• Genetic manipulation models: In knockout or knockdown models of ECM regulators, assess consequent changes in COL27A1 distribution and expression to elucidate regulatory pathways.

What approaches can be used to validate COL27A1 antibody specificity in cross-species studies?

When conducting cross-species studies, validating antibody specificity is crucial:

• Sequence homology analysis: Compare the immunogen sequence (LPGPKGDKGSRGDWGLQGPRGPPGPRGRPGPPGPPGGPIQLQQDDLGAAF) against the target species protein database to predict cross-reactivity. The predicted reactivity data indicates varying degrees of conservation: Human (100%), larger mammals (86%), rodents (85%), and zebrafish (85%) .

• Western blot validation: Run parallel Western blots with positive control samples from different species. Compare band patterns and molecular weights to confirm specificity. Known positive samples include: HeLa cells, HepG2 cells (human), mouse brain and heart tissues .

• Recombinant protein controls: Test antibody recognition using recombinant COL27A1 proteins from different species as positive controls.

• Blocking peptide experiments: Pre-incubate the antibody with the immunizing peptide before application to samples; this should abolish specific staining if the antibody is recognizing the correct epitope.

• Knockout/knockdown validation: Where available, use tissues or cells with confirmed genetic deletion or knockdown of COL27A1 as negative controls.

• Cross-absorption studies: For highly divergent species, consider cross-absorbing the antibody against proteins from the target species to reduce non-specific binding.

How should researchers interpret variations in COL27A1 banding patterns in Western blots across different tissue types?

Interpreting COL27A1 banding patterns requires careful consideration of several factors:

• Expected molecular weight: The predicted protein size for COL27A1 is approximately 90 kDa , but variations in observed molecular weights are common for collagens due to:

  • Post-translational modifications (glycosylation, hydroxylation)

  • Proteolytic processing of pro-collagen forms

  • Formation of multimeric complexes that may be incompletely denatured

• Tissue-specific processing: Different tissues may process COL27A1 differently, resulting in tissue-specific band patterns. Compare your results with positive controls such as HeLa cells, HepG2 cells, or mouse brain/heart tissues .

• Multiple band interpretation:

  • Higher molecular weight bands (>90 kDa): May represent full-length protein or post-translationally modified forms

  • Lower molecular weight bands: May indicate proteolytic fragments or alternative splice variants

  • Multiple bands: Could suggest tissue-specific processing or degradation during sample preparation

• Sample preparation effects: Variations in extraction protocols can affect band patterns. Standardize lysis buffers and protein extraction procedures across samples for more reliable comparisons.

• Quantitative analysis: For quantitative comparisons between samples, normalize COL27A1 signals to appropriate loading controls (β-actin, GAPDH) while recognizing that the relationship may not be linear across all expression levels.

What considerations are important when analyzing COL27A1 distribution patterns in immunohistochemistry studies?

When analyzing COL27A1 distribution in tissues:

• Subcellular localization assessment: As an extracellular matrix protein, COL27A1 should primarily show extracellular staining. Intracellular staining may represent newly synthesized protein within the secretory pathway.

• Cell type association: Determine which cell types are associated with COL27A1 deposition. This can provide insights into which cells are producing the protein versus which cellular environments contain the deposited protein.

• Staining pattern analysis:

  • Fibrillar patterns suggest incorporation into collagen fibrils

  • Diffuse staining may indicate non-fibrillar forms

  • Basement membrane-like patterns may suggest interactions with other ECM components

• Comparative analysis across tissues: Human placenta tissue can serve as a positive control for establishing baseline staining patterns . Compare experimental tissues to this reference.

• Quantification approaches:

  • Area measurement: Percentage of tissue area positive for COL27A1

  • Intensity scoring: Semi-quantitative assessment of staining intensity (0-3+)

  • Digital analysis: Software-based quantification of staining intensity and pattern

• Technical considerations:

  • Antigen retrieval effects: TE buffer at pH 9.0 is recommended for optimal epitope unmasking

  • Background assessment: Evaluate non-specific staining in negative controls

  • Detection system sensitivity: Adjust visualization methods based on expression levels