crebl2 Antibody

What is CREBL2 and why is it important in research?

CREBL2 (cAMP responsive element binding protein-like 2) is a protein that shares 41% identity with CRE-binding protein over a 48-base region encoding the bZip domain. This domain consists of basic residues involved in DNA binding and a leucine zipper motif for protein dimerization, suggesting CREBL2 has DNA binding capabilities . The frequent deletion of CREBL2 in hematopoietic malignancies and solid tumors (breast, non-small-cell lung, and ovarian cancers) suggests it may function as a tumor suppressor gene . Additionally, CREBL2 plays a critical role in adipogenesis and lipogenesis through its interaction with CREB, making it relevant to metabolic research .

What types of CREBL2 antibodies are commercially available for research?

Based on current research resources, several types of CREBL2 antibodies are available:

The selection encompasses both polyclonal antibodies for broader epitope recognition and monoclonal antibodies for higher specificity .

What are the standard validated applications for CREBL2 antibodies?

CREBL2 antibodies have been validated primarily for the following applications:

• Western Blot (WB): Most commonly validated application, with recommended dilutions ranging from 1:500 to 1:2000

• Enzyme-Linked Immunosorbent Assay (ELISA): Well-established application across multiple antibody providers

• Immunocytochemistry (ICC): Available with certain antibodies like Atlas Antibodies HPA043738

• Immunohistochemistry (IHC): Available with certain polyclonal antibodies

• Cytometric bead array: Validated for matched antibody pairs like Proteintech MP50393-2

The observed molecular weight for CREBL2 in Western blot applications is approximately 17 kDa, which is slightly higher than the calculated 14 kDa based on amino acid sequence .

What are the optimal conditions for Western blot detection of CREBL2?

For optimal Western blot detection of CREBL2:

• Sample preparation: CREBL2 has been successfully detected in human and mouse liver tissue samples

• Recommended dilutions: For polyclonal antibodies, use dilutions ranging from 1:500-1:1000 (Proteintech 18007-1-AP) to 1:500-1:2000 (Abbexa)

• Expected molecular weight: Look for bands at approximately 17 kDa

• Optimization: It is recommended to titrate the antibody in each testing system to obtain optimal results, as performance can be sample-dependent

• Storage and handling: Store antibodies at -20°C to ensure stability; Proteintech's antibody contains 0.02% sodium azide and 50% glycerol (pH 7.3) as a storage buffer

How should I design experiments to study CREBL2's role in adipogenesis?

Based on published research methodology :

• Cell model selection: Use 3T3-L1 preadipocytes as they show significant CREBL2 expression changes during differentiation

• Differentiation induction: Apply MDI (methylisobutylxanthine, dexamethasone, and insulin) protocol to trigger adipocyte differentiation

• Expression analysis:

  • Monitor CREBL2 mRNA levels via RT-PCR, with significant increases observed 48 hours after adipocytic induction

  • Track protein expression via Western blot during the differentiation timeline

• Functional studies:

  • Perform overexpression experiments using appropriate vectors

  • Conduct knockdown experiments using siRNA against CREBL2

  • Assess adipogenesis markers including PPARγ and C/EBPα expression

  • Evaluate lipogenesis by measuring GLUT1 and GLUT4 expression

• Protein interaction studies:

  • Investigate CREBL2-CREB interaction through co-immunoprecipitation

  • Analyze co-localization through immunofluorescence microscopy

  • Measure CREB phosphorylation status in relation to CREBL2 levels

What controls should be included when validating CREBL2 antibody specificity?

To ensure antibody specificity and validate experimental results:

• Positive controls:

  • Human and mouse liver tissue lysates have shown consistent CREBL2 detection

  • 3T3-L1 cells after 48 hours of adipogenic induction (for adipogenesis research)

• Negative controls:

  • Omission of primary antibody while keeping all other conditions identical

  • Pre-incubation of antibody with blocking peptide (if available)

  • Tissue or cells known to lack CREBL2 expression

• Knockdown/knockout validation:

  • Comparison with siRNA-mediated CREBL2 knockdown samples to confirm signal specificity

  • CRISPR/Cas9-generated CREBL2 knockout cells if available

• Cross-reactivity assessment:

  • Testing across multiple species (human, mouse, rat) if researching conserved functions

  • Comparison of polyclonal vs. monoclonal antibody results to verify consistent targets

How can I investigate CREBL2-CREB interaction mechanisms in experimental settings?

To investigate the CREBL2-CREB interaction mechanism thoroughly:

• Co-immunoprecipitation (Co-IP):

  • Immunoprecipitate with CREBL2 antibody and probe for CREB (or vice versa)

  • Use both overexpression systems and endogenous conditions to confirm physiological relevance

• Protein co-localization:

  • Perform immunofluorescence staining using CREBL2 and CREB antibodies

  • Analyze subcellular localization patterns using confocal microscopy

  • Research has shown that CREBL2 and CREB are entirely co-localized

• Functional dependency assays:

  • Conduct CREB knockdown experiments in CREBL2-overexpressing cells

  • Perform CREBL2 knockdown in CREB-overexpressing cells

  • Previous research has demonstrated that CREB depletion blocks the effects of overexpressed CREBL2, while increased CREB cannot drive adipogenesis without CREBL2

• Transcriptional activity measurement:

  • Utilize CRE-luciferase reporter assays to measure CREB transcriptional activity

  • Assess how CREBL2 knockdown affects CREB phosphorylation (a marker of CREB activation)

  • Research has shown that siCREBL2 can down-regulate CREB transcriptional activity and suppress CREB phosphorylation

• Protein domain mapping:

  • Generate truncated versions of CREBL2 to identify domains required for CREB interaction

  • Focus on the bZip domain, as it's likely involved in the interaction based on structural similarities

What approaches can be used to study CREBL2's potential tumor suppressor role?

To investigate CREBL2's potential tumor suppressor function:

• Expression analysis in cancer tissues:

  • Use validated CREBL2 antibodies for immunohistochemistry of tumor samples

  • Compare expression levels between tumor and adjacent normal tissue

  • Focus on hematopoietic malignancies, breast, non-small-cell lung, and ovarian cancers where CREBL2 deletion has been reported

• Functional studies in cancer cell lines:

  • Overexpress CREBL2 in cancer cell lines with low endogenous expression

  • Assess effects on proliferation, migration, invasion, and apoptosis

  • Evaluate changes in tumorigenic pathways using protein arrays or transcriptome analysis

• Loss-of-function studies:

  • Generate stable CREBL2 knockdown or knockout cell lines

  • Assess whether CREBL2 depletion enhances tumorigenic properties

  • Evaluate xenograft growth in animal models with modulated CREBL2 expression

• Mechanistic investigations:

  • Identify transcriptional targets of CREBL2 in cancer cells using ChIP-seq

  • Analyze protein interaction networks in cancer vs. normal cells

  • Investigate how CREBL2-CREB interaction affects cancer-relevant pathways

• Clinical correlation studies:

  • Correlate CREBL2 expression levels with patient survival and treatment response

  • Examine associations with specific cancer subtypes or staging

How can recombinant CREBL2 protein be utilized in antibody validation and functional studies?

Recombinant CREBL2 protein, such as the His-tagged mouse CREBL2 (AA 1-123) expressed in HEK-293 cells , offers several research applications:

• Antibody validation:

  • Use as a positive control in Western blots to confirm antibody specificity

  • Create standard curves for quantitative assays

  • Develop blocking peptides to verify signal specificity in immunostaining

• Structure-function studies:

  • Analyze protein-protein interactions through pull-down assays

  • Study binding dynamics with CREB and potential other partners

  • Perform in vitro DNA binding assays to identify genomic targets

• Development of novel detection methods:

  • Use as antigens to develop new monoclonal antibodies with enhanced specificity

  • Create protein standards for absolute quantification in complex samples

  • Develop protein arrays for high-throughput interaction studies

• Functional reconstitution:

  • Add purified protein to cell-free transcription systems to study direct effects on gene expression

  • Perform in vitro modification assays to identify post-translational regulation

  • Study protein stability and degradation mechanisms

The recombinant protein sequence: MDDSKVVGGKVKKPGKRGRKPAKIDLKAKLERSRQSARECRARKKL RYQYLEELVSSRERAICALREELEEMYKQWCMAMDQGKIPSEIRALL TGEEQSKPQQNSSRHPKAGKTDANTNSLVGN

How can I troubleshoot weak or absent CREBL2 signal in Western blotting?

When experiencing weak or absent CREBL2 signal in Western blotting:

• Sample preparation issues:

  • Ensure proper tissue/cell lysis with protease inhibitors

  • Try different lysis buffers that may better preserve CREBL2

  • Verify protein concentration and loading adequate amounts (start with 20-30 µg)

• Antibody-related considerations:

  • Try lower dilutions of antibody (1:500 instead of 1:1000)

  • Extend primary antibody incubation time (overnight at 4°C)

  • Test alternative CREBL2 antibodies (polyclonal may provide better sensitivity)

  • Verify antibody storage conditions and expiration date

• Protocol optimization:

  • Increase transfer time or modify transfer conditions for small proteins (~17 kDa)

  • Test different blocking reagents (BSA vs. milk)

  • Increase exposure time during detection

  • Consider using enhanced chemiluminescence substrates with higher sensitivity

• Biological considerations:

  • Verify CREBL2 expression in your experimental system (check transcript levels)

  • Consider induction conditions - CREBL2 shows significant increases 48 hours after adipocytic induction in 3T3-L1 cells

  • Check if experimental treatments might affect CREBL2 stability or expression

• Expected molecular weight considerations:

  • Look specifically at the 17 kDa range, as this is the observed molecular weight for CREBL2 despite its calculated 14 kDa size

What are potential sources of cross-reactivity when using CREBL2 antibodies?

Potential sources of cross-reactivity when using CREBL2 antibodies include:

• Structural homology:

  • CREBL2 shares 41% identity with CRE-binding protein in the bZip domain region

  • Cross-reactivity with other bZip-containing proteins is possible, especially with polyclonal antibodies

• Antibody-specific factors:

  • Polyclonal antibodies may recognize multiple epitopes, increasing cross-reactivity risk

  • Monoclonal antibodies may provide higher specificity but possibly lower sensitivity

  • The immunogen used for antibody generation affects specificity (Proteintech uses CREBL2 fusion protein Ag12504)

• Experimental conditions:

  • Higher antibody concentrations increase cross-reactivity risk

  • Inadequate blocking can lead to non-specific binding

  • Stringency of washing affects specificity

• Detection methods:

  • Western blotting allows molecular weight discrimination to identify false positives

  • Immunostaining techniques (IHC, ICC) may be more prone to cross-reactivity artifacts

• Validation approaches:

  • Compare results across multiple antibodies targeting different CREBL2 epitopes

  • Include CREBL2 knockdown/knockout controls

  • Pre-absorb antibody with recombinant CREBL2 to confirm specificity

How should I optimize CREBL2 antibody conditions for different experimental systems?

For optimizing CREBL2 antibody use across different experimental systems:

• Western blotting optimization:

  • Start with manufacturer's recommended dilution range (e.g., 1:500-1:1000 for Proteintech)

  • Perform titration experiments testing multiple dilutions

  • Optimize blocking conditions (5% milk or BSA) and incubation times

  • If working with different species, verify cross-reactivity (human, mouse, and rat reactivity has been confirmed)

• Immunostaining (IHC/ICC) optimization:

  • Test multiple antigen retrieval methods (heat-induced vs. enzymatic)

  • Optimize antibody concentration and incubation time/temperature

  • Validate with appropriate positive control tissues

  • Consider detection system sensitivity (HRP vs. fluorescence-based)

• ELISA and protein array applications:

  • Determine optimal coating concentration for direct ELISA

  • For sandwich ELISA, test different capture/detection antibody combinations

  • Matched antibody pairs (like Proteintech MP50393-2) are specifically designed for immunoassays

• Cytometric bead array optimization:

  • Follow validated protocols for specific pairs like MP50393-2

  • The working range for Proteintech's matched antibody pair is 6.25-100 ng/mL

• Cell/tissue-specific considerations:

  • Liver tissue has been validated for CREBL2 detection

  • For adipogenesis studies, 3T3-L1 cells show strong induction 48 hours post-differentiation

  • Optimization may be required for each specific cell line or tissue type

What emerging techniques could enhance CREBL2 research beyond traditional antibody applications?

Several cutting-edge techniques could advance CREBL2 research beyond conventional antibody applications:

• CRISPR/Cas9 genome editing:

  • Generate CREBL2 knockout cell lines for definitive functional studies

  • Create epitope-tagged endogenous CREBL2 for improved detection

  • Introduce specific mutations to study structure-function relationships

• Proximity labeling approaches:

  • BioID or APEX2 fusions with CREBL2 to identify novel interaction partners

  • TurboID for rapid biotin labeling of CREBL2-proximal proteins

  • Spatial mapping of CREBL2 interactome in different cellular compartments

• Advanced imaging techniques:

  • Super-resolution microscopy of CREBL2-CREB interactions

  • Live-cell imaging with fluorescently tagged CREBL2

  • FRET/BRET assays to measure dynamic interactions with CREB

• Single-cell analysis:

  • Single-cell RNA-seq to identify cell populations with differential CREBL2 expression

  • CyTOF with CREBL2 antibodies for high-dimensional protein analysis

  • Spatial transcriptomics to map CREBL2 expression in tissue contexts

• Protein structure determination:

  • Cryo-EM of CREBL2-CREB complexes

  • X-ray crystallography of CREBL2 binding domains

  • NMR studies of CREBL2 interactions with DNA and protein partners

How might CREBL2 research contribute to understanding metabolic diseases and cancer?

CREBL2 research holds significant potential for understanding both metabolic diseases and cancer:

• Metabolic disease insights:

  • CREBL2's role in adipogenesis suggests it may influence obesity development

  • The CREBL2-CREB pathway affects expression of PPARγ and C/EBPα, master regulators of adipocyte differentiation

  • CREBL2 impacts GLUT1 and GLUT4 expression, linking it to glucose metabolism and potentially diabetes

  • Understanding how CREBL2 regulates fat cell formation could identify novel therapeutic targets

• Cancer biology contributions:

  • CREBL2 deletion occurs in hematopoietic malignancies and solid tumors (breast, lung, ovarian)

  • Its potential tumor suppressor role may reveal new insights into cancer development

  • The CREBL2-CREB interaction might influence cancer cell metabolism and growth

  • CREBL2 status could serve as a prognostic biomarker or therapeutic vulnerability

• Intersection of metabolism and cancer:

  • Metabolic reprogramming is a hallmark of cancer

  • CREBL2's dual role in adipogenesis and as a potential tumor suppressor makes it relevant to the metabolism-cancer connection

  • Understanding how CREBL2 regulates cellular energy pathways could reveal mechanisms underlying both conditions

• Translational potential:

  • Development of CREBL2-targeted therapeutics for metabolic diseases

  • Diagnostic applications of CREBL2 in cancer subtyping

  • Precision medicine approaches based on CREBL2 status in tumors

  • Interventions targeting the CREBL2-CREB axis in both disease contexts

What are the most reliable antibody-based approaches for studying CREBL2 in research?

Based on the available data, the most reliable antibody-based approaches for CREBL2 research include:

• Western blotting:

  • Most consistently validated application across multiple antibodies

  • Provides molecular weight confirmation (17 kDa) to ensure specificity

  • Both polyclonal (Proteintech 18007-1-AP, Abbexa) and monoclonal options available

• Combined approach strategies:

  • Verify findings using multiple antibodies targeting different epitopes

  • Complement protein detection with mRNA analysis (RT-PCR)

  • Incorporate functional studies (overexpression/knockdown) to validate antibody results

  • Include appropriate positive controls (liver tissue, differentiated 3T3-L1 cells)

• Context-specific recommendations:

  • For adipogenesis studies: Western blot with time-course sampling post-differentiation

  • For cancer research: IHC on tissue microarrays to assess expression patterns

  • For protein interaction studies: Co-IP followed by Western blot detection

  • For quantitative analysis: ELISA or cytometric bead array using validated antibody pairs

• Technical best practices:

  • Follow manufacturer's recommended dilutions and protocols initially

  • Optimize conditions for each specific experimental system

  • Include appropriate negative controls (knockdown samples, isotype controls)

  • Maintain consistent experimental conditions for comparative studies