The CRTAP antibody is a primary antibody used in molecular biology research to detect the Cartilage-associated Protein (CRTAP), a key component in collagen prolyl 3-hydroxylation. This antibody is critical for studying CRTAP's role in skeletal development, bone disorders, and collagen-related diseases. Two prominent commercial variants, HPA044150 and HPA043598, are widely utilized in academic and clinical research, with distinct specifications and applications.
The CRTAP antibody is validated for:
Immunohistochemistry (IHC): Detects CRTAP in tissue sections, particularly in bone, cartilage, and skin .
Immunofluorescence (ICC-IF): Localizes CRTAP within the endoplasmic reticulum of cells .
Western Blotting (WB): Identifies CRTAP protein expression levels in lysates .
| Antibody Details | HPA044150 | HPA043598 |
|---|---|---|
| Species Reactivity | Human, Mouse, Rat | Human |
| Immunogen Sequence | LVYYQYHRDTWGLSDEHFQPRPEAVQFFNVTTLQKELYDFAKENIMDDDEGEVVEYVDDLLELEET | RAHCLKRCKQGLPAFRQSQPSREVLADFQRREPYKFLQFAYFKANNLPKAIAAAHTFLLKHPDDEMMKRNMAYYKSLPGAEDYIKDLE |
| IHC Dilution | 1:20–1:50 | 1:50–1:200 |
| ICC-IF Dilution | 0.25–2 μg/mL | Not listed |
CRTAP forms a heterotrimeric complex with P3H1 and PPIB, enabling prolyl 3-hydroxylation of collagen. Cryo-EM studies reveal a bifunctional reaction center in this complex, where CRTAP stabilizes P3H1's enzymatic activity .
Mutations in CRTAP cause recessive OI, characterized by fragile bones. Preclinical studies show that Sclerostin antibody (Scl-Ab) treatment improves bone parameters in Crtap−/− mice, suggesting therapeutic potential .
CRTAP is strongly expressed in bone, cartilage, lung, kidney, and skin, with weaker presence in liver and brain . Its localization in the ER highlights its role in collagen synthesis .
The Human Protein Atlas project validates these antibodies through tissue arrays (44 normal tissues, 20 cancers) and protein arrays (364 recombinant fragments) . They are available from Sigma-Aldrich and Atlas Antibodies at $598.00 per 100 μL vial .
CRTAP plays a critical role in collagen formation and has been implicated in various skeletal disorders, particularly osteogenesis imperfecta (OI). Research has highlighted its significance in the following ways:
CRTAP (Cartilage Associated Protein) is a scaffold protein that forms a heterotrimeric complex with P3H1 and PPIB, involved in post-translational modification of type I collagen. This complex catalyzes the prolyl-3-hydroxylation of proline-986 in pro-α1(I) and pro-α2(I) chains, while also functioning as a collagen chaperone. Additionally, the complex demonstrates disulfide isomerase activity due to the presence of 'CxxxC' motifs in both CRTAP and P3H1 . CRTAP is primarily located in the endoplasmic reticulum but can also be secreted into the extracellular matrix . Research interest in CRTAP has intensified since the discovery that defects in this gene are associated with osteogenesis imperfecta, a connective tissue disorder characterized by bone fragility and low bone mass .
Several types of CRTAP antibodies are available for research applications:
Most commercially available CRTAP antibodies are rabbit polyclonal antibodies that recognize human CRTAP, though antibodies with reactivity to other species like mouse are also available .
CRTAP antibodies are utilized in multiple research applications:
Western Blotting (WB): For detecting CRTAP protein expression levels in cell or tissue lysates
Immunohistochemistry (IHC): For examining CRTAP localization in tissue sections
Immunocytochemistry/Immunofluorescence (ICC-IF): For studying subcellular localization
Enzyme-Linked Immunosorbent Assay (ELISA): For quantitative measurement of CRTAP levels
SDS-PAGE: For analyzing CRTAP protein purity and molecular weight
Researchers should verify the validated applications for each specific antibody, as not all antibodies are suitable for every technique.
When selecting a CRTAP antibody, researchers should consider:
Application compatibility: Verify the antibody has been validated for your intended application (WB, IHC, ELISA, etc.)
Species reactivity: Ensure the antibody recognizes CRTAP from your species of interest
Antibody type: Consider whether polyclonal (broader epitope recognition) or monoclonal (higher specificity) is more appropriate for your research needs
Epitope location: Check which region of CRTAP the antibody targets, especially if studying specific domains or isoforms
Validation data: Review published literature citations demonstrating successful use of the antibody
Form and storage: Consider antibody format (e.g., unconjugated, conjugated) and storage requirements
Making these considerations before purchase can save significant time and resources in experimental troubleshooting.
Validation of CRTAP antibodies should follow a systematic approach:
Genetic validation: Use CRTAP knockout/knockdown samples as negative controls to confirm antibody specificity
Orthogonal validation: Compare results with alternative detection methods (e.g., mass spectrometry)
Independent antibody validation: Test multiple antibodies targeting different epitopes of CRTAP
Expression system validation: Use cells transfected with tagged CRTAP to confirm detection
Immunocapture followed by mass spectrometry: Verify that the antibody pulls down CRTAP specifically
CRTAP antibodies are valuable tools for studying osteogenesis imperfecta (OI) through several approaches:
Protein expression analysis: Western blotting with CRTAP antibodies can quantify expression levels in patient-derived cells compared to controls, helping to correlate genotype with phenotype
Tissue localization: Immunohistochemistry can reveal altered localization patterns in bone tissues from OI patients
Therapeutic efficacy assessment: In animal models like Crtap(-/-) mice, CRTAP antibodies can be used to monitor protein expression during treatment with potential therapeutics like sclerostin-neutralizing antibodies (Scl-Ab)
Protein-protein interaction studies: Co-immunoprecipitation with CRTAP antibodies can investigate altered interactions with P3H1 and PPIB in OI contexts
Collagen processing analysis: CRTAP antibodies can help track collagen processing defects by examining colocalization with collagen and ER markers
Research has shown that Scl-Ab treatment significantly improved bone volume and trabecular microarchitecture in Crtap(-/-) mice, suggesting potential therapeutic applications for recessive OI caused by CRTAP defects .
Detection and characterization of mutant CRTAP isoforms requires careful experimental design:
Epitope consideration: Select antibodies recognizing regions not affected by the mutation of interest
Combined DNA and protein analysis: Correlate transcript analysis (e.g., RT-PCR) with protein detection (Western blot) to understand expression patterns of mutant isoforms
Proteasome inhibition: Treat cells with proteasomal inhibitors (e.g., MG132) to detect unstable mutant CRTAP isoforms that might be rapidly degraded
Subcellular fractionation: Use CRTAP antibodies with cellular compartment markers to determine if mutations affect protein localization
Pulse-chase experiments: Combine CRTAP antibodies with metabolic labeling to track protein stability and degradation rates
As demonstrated in research on deep intronic mutations in CRTAP, mutant isoforms (CRTAP-Mut1 and CRTAP-Mut2) were only detectable after proteasomal inhibition, indicating rapid degradation of these proteins in patient fibroblasts .
When faced with contradictory results using CRTAP antibodies, consider these methodological approaches:
Multiple antibody validation: Test several CRTAP antibodies targeting different epitopes to confirm findings
Technical optimization: Systematically adjust antibody concentrations, incubation times, and blocking conditions
Sample preparation variation: Compare different protein extraction methods to ensure optimal CRTAP preservation
Positive and negative controls: Include CRTAP overexpression systems and knockout samples
Cross-reactivity assessment: Perform peptide competition assays to confirm specificity
Orthogonal technique confirmation: Validate findings using non-antibody-based methods like mass spectrometry
Isoform-specific detection: Design experiments to distinguish between potential CRTAP isoforms
Recent research has demonstrated that intronic mutations can produce multiple CRTAP transcript variants with differential stability, highlighting the importance of considering post-transcriptional regulation when interpreting antibody results .
Optimal Western blotting conditions for CRTAP detection:
Sample preparation:
Gel electrophoresis:
Transfer and detection:
Signal development:
ECL detection systems are suitable for most applications
Consider signal enhancement systems for low-abundance detection
Always validate dilutions and conditions empirically for each new lot of antibody.
To improve immunohistochemical staining with CRTAP antibodies:
Fixation optimization:
Compare different fixatives (formalin, paraformaldehyde, methanol)
Optimize fixation duration to preserve epitopes while maintaining tissue architecture
Antigen retrieval:
Test heat-induced epitope retrieval methods (citrate buffer pH 6.0, EDTA buffer pH 9.0)
Compare microwave, pressure cooker, and water bath methods
Optimize retrieval duration (typically 10-20 minutes)
Antibody conditions:
Background reduction:
Optimize blocking (e.g., 5-10% normal serum from the same species as secondary antibody)
Include avidin/biotin blocking if using biotin-based detection
Consider tissue-specific autofluorescence quenching methods
Controls:
Include negative controls (primary antibody omission, isotype controls)
Use tissues with known CRTAP expression patterns as positive controls
Carefully document all optimization steps for reproducibility across experiments.
Non-specific binding can be addressed through:
Antibody titration:
Test serial dilutions to find optimal signal-to-noise ratio
Start with manufacturer's recommended dilution and adjust accordingly
Blocking optimization:
Test different blocking agents (BSA, normal serum, commercial blockers)
Increase blocking time or concentration
Add 0.1-0.3% Triton X-100 for better penetration in ICC/IF
Washing protocol adjustment:
Increase washing duration and frequency
Test different detergent concentrations in wash buffers
Pre-adsorption:
Pre-incubate antibody with recombinant CRTAP protein to neutralize specific binding
Compare with regular antibody to identify non-specific signals
Secondary antibody optimization:
Try different secondary antibodies
Consider using highly cross-adsorbed secondary antibodies
Sample preparation:
Ensure complete protein denaturation for Western blotting
Optimize permeabilization for ICC/IF applications
Careful documentation of optimization steps will facilitate troubleshooting and protocol refinement.
CRTAP antibodies can facilitate advanced studies of collagen post-translational modifications through:
Co-immunoprecipitation assays:
Pull down CRTAP-P3H1-PPIB complexes to study associated collagen substrates
Analyze modifications on co-precipitated collagen molecules
Proximity ligation assays:
Visualize and quantify interactions between CRTAP and collagen processing enzymes
Map spatial relationships within the ER during collagen modification
CRISPR-engineered systems:
Use CRTAP antibodies to validate knockout/knockin models
Study the effects of specific CRTAP mutations on collagen processing
Mass spectrometry integration:
Immunoprecipitate CRTAP-associated complexes for proteomic analysis
Identify novel interacting partners in the collagen modification pathway
Live-cell imaging:
Combine with fluorescently-tagged collagen to track real-time processing
Analyze trafficking dynamics of CRTAP-collagen complexes
Research has established that the CRTAP-P3H1-PPIB complex plays multiple roles beyond prolyl-3-hydroxylation, including functioning as a collagen chaperone and disulfide isomerase, highlighting the importance of studying this complex in collagen biogenesis .
Innovative methodological approaches combining CRTAP antibodies with advanced imaging include:
Super-resolution microscopy:
STORM or PALM imaging for nanoscale localization of CRTAP within the ER
Resolve CRTAP distribution relative to collagen fibrils at sub-diffraction resolution
FRET/FLIM analysis:
Measure molecular distances between CRTAP and interaction partners
Study conformational changes during complex assembly
Correlative light and electron microscopy (CLEM):
Localize CRTAP immunolabeling at ultrastructural level
Study spatial relationship to collagen processing structures
Live-cell single-molecule tracking:
Monitor dynamics of fluorescently-tagged CRTAP with high temporal resolution
Analyze diffusion patterns and binding kinetics in living cells
Expansion microscopy:
Physically expand samples to improve resolution of CRTAP localization
Study nanoscale organization within the ER
Lightsheet microscopy:
Visualize 3D distribution of CRTAP in whole tissues or organoids
Track developmental changes in expression patterns
These approaches can reveal previously uncharacterized aspects of CRTAP function in normal development and disease states.
Systems biology approaches for integrating CRTAP antibody data include:
Multi-omics integration:
Correlate CRTAP protein levels (antibody-based) with transcriptomics, metabolomics, and clinical data
Build comprehensive models of collagen processing networks
Pathway reconstruction:
Place CRTAP in context of collagen biosynthesis and modification pathways
Identify regulatory nodes and feedback mechanisms
Single-cell analysis:
Use CRTAP antibodies for single-cell protein quantification
Correlate with single-cell transcriptomics to identify cell-specific regulation
Network perturbation analysis:
Quantify system-wide effects of CRTAP disruption using antibody-based proteomics
Model consequences of mutations on entire collagen biogenesis pathways
Mathematical modeling:
Incorporate antibody-derived quantitative data into kinetic models
Predict effects of therapeutic interventions on CRTAP-dependent processes
Longitudinal studies:
Track CRTAP expression during development or disease progression
Correlate with functional outcomes and biomarkers
Such approaches can advance our understanding of how CRTAP defects lead to osteogenesis imperfecta and may reveal novel therapeutic targets.