CYP24A1 Antibody

What is CYP24A1 and why is it important in research?

CYP24A1 (Cytochrome P450 family 24 subfamily A member 1) is a mitochondrial enzyme that plays a crucial role in vitamin D metabolism. It catalyzes the inactivation of both vitamin D precursor calcidiol (25-hydroxyvitamin D3) and the active hormone calcitriol (1α,25-dihydroxyvitamin D3) through C24- and C23-oxidation pathways . The enzyme is significant in research because:

• It regulates vitamin D bioavailability and calcium homeostasis

• It's frequently overexpressed in various cancer types

• Its expression correlates with cancer progression and patient survival

• It potentially neutralizes the anti-tumor effects of vitamin D

Recent studies have shown that CYP24A1 may function beyond just vitamin D catabolism, with evidence suggesting roles in cell cycle regulation and tumorigenesis independent of its catalytic activity .

What are the primary applications for CYP24A1 antibodies in research?

CYP24A1 antibodies are utilized in multiple experimental approaches:

These applications allow researchers to detect CYP24A1 expression levels, subcellular localization, and interactions with other proteins in experimental settings .

How should sample preparation be optimized for CYP24A1 detection?

For optimal CYP24A1 detection:

• Cell/Tissue Lysate Preparation: Use mitochondrial isolation protocols when possible, as CYP24A1 is primarily localized in mitochondria

• Fixation for IHC/IF:

  • For FFPE tissues: Standard formalin fixation is adequate

  • Antigen retrieval: Most effective using TE buffer pH 9.0; citrate buffer pH 6.0 may be used as an alternative

• Blocking Conditions: Use 5% BSA in PBS or TBS to reduce background

• Protein Denaturation: For Western blotting, avoid excessive heating of samples as this may affect the native conformation of CYP24A1, potentially reducing antibody recognition

How can I validate the specificity of my CYP24A1 antibody?

Comprehensive validation should include:

• Genetic Controls:

  • Use CYP24A1 knockdown/knockout cells as negative controls

  • Results from studies show complete absence of signal in CYP24A1-null mice confirms antibody specificity

• Expression Correlation:

  • Verify correlation between protein detection and mRNA expression

  • Research demonstrates strong correlation (r = 0.87) between CYP24A1 protein detected by IHC and mRNA levels detected by qRT-PCR

• Orthogonal Validation:

  • Compare results with RNAseq data

  • Multiple antibodies targeting different epitopes should yield similar results

• Recombinant Protein Controls:

  • Use purified recombinant CYP24A1 as positive control

  • Test against closely related CYP family members (e.g., CYP2R1) to confirm specificity

• Immunogen Competition:

  • Pre-incubate antibody with immunizing peptide before application to confirm binding specificity

What factors affect CYP24A1 expression during cell cycle and how should this influence experimental design?

Research has revealed cell cycle-dependent expression of CYP24A1, with important implications for experimental design:

• Expression Pattern:

  • CYP24A1 expression is highest during G2-M phase

  • Expression diminishes upon G1 entry

  • Expression pattern mirrors that of cyclin B1

• Cell Synchronization Considerations:

  • For maximum protein detection, collect cells 8-10 hours after release from double thymidine block

  • For minimum expression, collect at 12 hours post-release

• Experimental Recommendations:

  • Ensure consistent cell cycle state when comparing CYP24A1 levels between experimental conditions

  • Include cell cycle markers (e.g., cyclin B1) in analyses

  • For cancer studies, consider that rapidly proliferating cells may have higher baseline CYP24A1 expression

  • When assessing drug effects on CYP24A1, control for potential cell cycle arrest effects

How should CYP24A1 antibody performance be validated across different cancer models?

Evidence indicates variable CYP24A1 expression across cancer types with significant research implications:

• Expression Patterns in Different Cancers:

  • Lung adenocarcinoma: 8-50 fold elevation compared to normal tissue

  • Breast cancer: Higher expression in triple-negative subtype correlates with poor prognosis

  • Colorectal cancer: Expression increases during carcinogenesis

  • Thyroid cancer: Expression contributes to tumor progression in BRAF-induced models

• Validation Approach:

  • Test antibody in multiple cell lines with varying endogenous CYP24A1 levels

  • Include paired normal/tumor tissue for comparison

  • Verify antibody works in cell lines relevant to your cancer model (e.g., A549 for lung cancer, MCF7 for breast cancer)

• Technical Considerations:

  • Adjust exposure times for Western blot detection based on expected expression level

  • For IHC scoring, establish cancer-specific thresholds (e.g., >50% area with 3+ intensity considered positive in breast cancer studies)

  • Consider gene amplification status (20q amplification can drive CYP24A1 overexpression in some cases)

How can CYP24A1 antibodies be used to investigate vitamin D resistance mechanisms in cancer?

Methodological approach:

• Expression Analysis Workflow:

  • Measure CYP24A1 protein levels using antibodies in cancer cells before and after vitamin D treatment

  • Simultaneously assess vitamin D receptor (VDR) expression

  • Correlate with functional vitamin D response (e.g., growth inhibition)

• Experimental Design:

  • Compare high vs. low CYP24A1-expressing cell lines (e.g., A549 vs. SKLU-1 in lung cancer)

  • Results show high CYP24A1-expressing cells (A549) are more resistant to anti-proliferative effects of 1,25-D3

  • Test paired cell lines with CYP24A1 knockdown/overexpression

• Combined Inhibitor Studies:

  • Research shows CYP24A1 inhibition with compounds like KD-35 enhances vitamin D's anti-proliferative effects

  • In colorectal cancer studies, inhibition dramatically increased sensitivity to vitamin D treatment (35.81% reduction in cell proliferation with combined treatment vs. vitamin D alone)

  • Antibodies can confirm inhibitor-mediated reduction in CYP24A1 activity is not due to reduced protein expression

What is the relationship between CYP24A1 and cell cycle regulation, and how can antibodies help elucidate this connection?

Recent research has revealed unexpected roles for CYP24A1 in cell cycle regulation:

• CYP24A1 and APC/C Interaction:

  • CYP24A1 contains a functional destruction box (D-box) motif

  • This allows binding to APC adaptors CDH1 and CDC20

  • CYP24A1 acts as a pseudo-substrate, inhibiting CDH1 activity and promoting mitotic progression

• Experimental Approach Using Antibodies:

  • Co-immunoprecipitation with CYP24A1 antibodies can detect interactions with CDH1/CDC20

  • Mutation of D-box residues (specifically D#2 at Arg-223 and Lys-226) reduces this interaction

  • Western blotting can track degradation patterns of CYP24A1 and cell cycle regulators

• Key Finding:

  • CYP24A1's oncogenic potential may be independent of its catalytic activity

  • CYP24A1 isoform 2 lacking the catalytic cysteine (Cys-462) still demonstrates these cell cycle effects

How can CYP24A1 antibodies be utilized to develop prognostic markers in cancer research?

Several studies demonstrate CYP24A1's prognostic value:

How should results be interpreted when CYP24A1 protein levels don't correlate with mRNA expression?

This common research challenge has several potential explanations and solutions:

• Post-Transcriptional Regulation:

  • CYP24A1 protein levels are subject to proteasomal degradation

  • Cell cycle-dependent fluctuations occur independent of transcription

• Technical Considerations:

  • Antibody may detect specific CYP24A1 isoforms not represented by PCR primers

  • Ensure antibody specificity for detecting denatured vs. native protein forms

• Experimental Approach:

  • Assess protein stability with cycloheximide chase experiments

  • Examine ubiquitination status using immunoprecipitation with CYP24A1 antibodies followed by ubiquitin Western blot

  • Test multiple antibodies recognizing different epitopes

• Research Context:

  • In lung cancer studies, a significant correlation (r = 0.94, n = 47, P < 0.01) was observed between mRNA by microarray and qRT-PCR

  • Protein-mRNA correlation was strong in some tissues (r = 0.87)

What factors cause variability in CYP24A1 detection across different antibodies?

Understanding antibody variability is essential for reliable research:

• Epitope Differences:

  • Different commercial antibodies target distinct regions of CYP24A1

  • Prestige Antibodies (HPA022261) immunogen spans amino acids DFLCDIYHQNRLSKKELYAAVTELQLAAVETTANSLMWILYNLSRNPQVQQKLLKEIQSVLPENQVPRAEDLRNMPYLKACLKESMRLTPSVPFTTRTLDKATVLGEYALPKGTVLMLNTQV

  • CAB1805 targets amino acids 36-448 of human CYP24A1

  • Some epitopes may be masked in particular conformations or protein complexes

• Isoform Specificity:

  • CYP24A1 has multiple isoforms, including a catalytically inactive isoform 2

  • Most available antibodies cannot distinguish between isoforms

  • Research shows isoform 2 lacking the catalytic cysteine (Cys-462) still has biological activity

• Technical Recommendations:

  • Validate new antibodies against known positive controls

  • Use genetic knockdown controls

  • Consider using multiple antibodies targeting different epitopes

  • Document which antibody was used when reporting results

What are the optimal conditions for detecting low levels of CYP24A1 protein in normal tissues?

CYP24A1 is typically expressed at low levels in normal tissues, presenting detection challenges:

• Signal Amplification Methods:

  • For Western blotting: Use enhanced chemiluminescence (ECL) substrate with longer exposure times

  • For IHC: Consider tyramine signal amplification or polymer-based detection systems

  • For IF: Use high-sensitivity fluorophores and confocal microscopy

• Sample Preparation Enhancement:

  • Enrich for mitochondrial fractions when possible

  • Use protein concentration methods for dilute samples

  • For normal kidney tissue (which naturally expresses CYP24A1), use as positive control

• Antibody Optimization:

  • Test concentration ranges: WB (1:500-1:1000), IHC (1:20-1:200)

  • Longer primary antibody incubation (overnight at 4°C)

  • Multiple antibodies report observed molecular weight of 54-59 kDa

How can CYP24A1 antibodies be used to investigate cell death mechanisms in cancer therapies?

Recent research reveals connections between CYP24A1 and cell death pathways:

• CYP24A1 and Apoptosis Sensitivity:

  • CYP24A1 knockdown increases sensitivity to apoptosis

  • Studies show increased cleaved caspase-3 in CYP24A1-suppressed cells under oxidative stress

  • CYP24A1 suppression increases apoptotic bodies in response to moderate H2O2 levels (100 μM)

• Experimental Protocol:

  • Assess apoptosis markers (cleaved caspase-3, PARP cleavage) by immunoblotting

  • Use CYP24A1 antibodies to confirm knockdown efficiency

  • Combine with tumor cell death assays to correlate CYP24A1 levels with therapy response

• Therapeutic Applications:

  • CYP24A1 suppression significantly enhances cell death sensitivity to chemotherapeutic drugs with different mechanisms (cisplatin and gefitinib)

  • Antibodies can monitor CYP24A1 levels during treatment to predict drug sensitivity

What role does CYP24A1 play in cancer cell metabolism beyond vitamin D catabolism?

Emerging research suggests broader metabolic implications:

• Non-Canonical Functions:

  • CYP24A1 shows oncogenic activity independent of its vitamin D catalytic activity

  • Cell cycle effects occur even with catalytically inactive isoform 2

  • Potential metabolic activities on substrates beyond vitamin D derivatives

• Research Approaches Using Antibodies:

  • Immunoprecipitate CYP24A1 to identify novel interacting proteins

  • Compare metabolic profiles between CYP24A1 wildtype and catalytic mutants

  • Assess localization to specialized mitochondrial subdomains using super-resolution microscopy

• Cancer Metabolism Connections:

  • CYP24A1 involvement in ferroptosis resistance in colorectal cancer through epigenetic activation

  • Potential link to RAS signaling pathway in lung cancer proliferation

How can CYP24A1 antibodies contribute to developing combination therapies targeting vitamin D pathways in cancer?

Strategic applications for combination therapy development:

• Monitoring CYP24A1 Inhibitor Efficacy:

  • Antibodies confirm target engagement without affecting protein levels

  • Study shows CYP24A1 mRNA expression was unchanged by KD-35 inhibitor treatment

  • Combination with vitamin D showed enhanced anti-proliferative effects

• BRAF Inhibitor Combinations:

  • Research demonstrates CYP24A1 attenuation strengthens antitumor responses to BRAF V600E inhibitor PLX4720

  • CYP24A1-null cells showed nearly abolished tumorigenic potential in immunocompromised mice

  • CYP24A1 antibodies can track protein levels during treatment to optimize dosing

• Pathway Analysis:

  • CYP24A1 knockdown affects multiple signaling pathways (MAPK, PI3K/Akt, TGFβ)

  • Loss of epithelial-mesenchymal transition (EMT) in CYP24A1-null cells

  • Antibodies can monitor these changes in combination therapy settings