deg-1 Antibody

Shipped with Ice Packs
In Stock

Description

Deg1 Antibody in Plant Biology

Target: Chloroplastic DegP-type serine protease 1 (Deg1), a member of the S1 chymotrypsin protease family in Arabidopsis thaliana. Deg1 localizes to chloroplasts and plays roles in protein quality control and stress responses.

Key Antibody Features:

  • Supplier: Agrisera (Product No. AS12 1858) .

  • Reactivity: Confirmed in Pisum sativum (pea) and Arabidopsis thaliana thylakoid fractions .

  • Applications:

    • Immunofluorescence (1:500 dilution) with chemiluminescent detection.

    • Western blotting (unspecific bands observed at ~30 kDa and ~85 kDa; Deg1 confirmed via mass spectrometry) .

Research Findings:

  • Deg1 is critical for maintaining chloroplast function under stress conditions.

  • Antibody validation includes reactivity with recombinant Deg1 expressed in E. coli .

DEGS1 Antibody in Human Biology

Target: Human DEGS1 (UniProt: Q8WV18), a sphingolipid delta-4-desaturase involved in ceramide metabolism. Dysregulation links to obesity and neurological disorders .

Key Antibody Features:

  • Supplier: Sigma-Aldrich (Product No. HPA076422) .

  • Immunogen Sequence: Synthetic peptide corresponding to residues YDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE .

  • Applications:

    • Immunofluorescence (0.25–2 µg/mL).

    • Validated in the Human Protein Atlas for subcellular localization studies .

Research Findings:

  • DEGS1 localizes to endoplasmic reticulum-mitochondria contact sites, influencing sphingolipid synthesis .

  • Prestige Antibodies® are extensively validated for specificity using protein arrays and tissue microarrays .

Comparative Analysis of DEG-1 Antibodies

ParameterPlant Deg1 AntibodyHuman DEGS1 Antibody
Target FunctionChloroplast proteaseSphingolipid desaturase
Species ReactivityPlants (A. thaliana, pea)Human
Key ApplicationsImmunofluorescence, Western blotImmunofluorescence, Protein Atlas
Critical Validation DataMass spectrometry confirmationProtein array, tissue microarray
Relevant DiseasesChloroplast stress responsesObesity, neurological disorders

Research Implications

  • Plant Studies: Deg1 antibodies enable exploration of chloroplast protein degradation mechanisms under environmental stress .

  • Human Studies: DEGS1 antibodies aid in mapping sphingolipid metabolism pathways and their roles in metabolic diseases .

Technical Considerations

  • Cross-Reactivity: Anti-Deg1 antibodies may show unspecific bands; confirmatory assays (e.g., knockout controls) are recommended .

  • Storage: Human DEGS1 antibodies require storage at -20°C in glycerol buffer .

Product Specs

Buffer
Preservative: 0.03% Proclin 300
Constituents: 50% Glycerol, 0.01M PBS, pH 7.4
Form
Liquid
Lead Time
Made-to-order (14-16 weeks)
Synonyms
deg-1 antibody; C47C12.6/C47C12.1Degenerin deg-1 antibody; Degeneration of certain neurons protein 1 antibody
Target Names
deg-1
Uniprot No.

Target Background

Function
DEG-1 is a probable sodium channel subunit. It is required by a subset of neurons.
Gene References Into Functions
  1. Research indicates that DEG/ENaC channels, but not TRP channels, play a crucial role in later stages of sensory perception: encoding and transmission of sensory information, but not in detection. PMID: 21903078
  2. The glial DEG/ENaC channel ACD-1 functions in conjunction with the neuronal channel DEG-1 to mediate specific sensory functions in C. elegans. PMID: 18701922
Database Links
Protein Families
Amiloride-sensitive sodium channel (TC 1.A.6) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is DEG-1 and what cellular functions does it perform?

DEG-1 (also known as DEGP1 or degradation of periplasmic proteins 1) is a nuclear-encoded protease targeted to the chloroplast thylakoid lumen. It functions as a general-purpose protease capable of degrading lumenal proteins including plastocyanin and OE33. Most significantly, DEG-1 plays a critical role in the degradation of the D1 protein of photosystem II (PSII), making it an essential component in the repair mechanism following photoinhibition damage . This function positions DEG-1 as a key factor in maintaining photosynthetic efficiency under stress conditions. Recent research published in Nature Communications has connected DEG-1 to the N6-methyladenosine RNA modification pathway that regulates photosynthesis during photodamage response in plants .

What are the structural characteristics of DEG-1 antibodies?

DEG-1 antibodies are typically polyclonal antibodies raised in rabbits against the Arabidopsis thaliana DEG-1 protein. These antibodies recognize specific epitopes of the DEG-1 protease, which has the official enzyme classification EC 3.4.21.- (serine proteases) . The antibodies are generally purified through immunogen affinity chromatography or antigen-affinity methods to ensure high specificity . Like other research antibodies, they consist of variable regions (Fv) that determine binding specificity, with complementarity-determining regions (CDRs) providing the specific antigen recognition domains. These structural elements can be analyzed using antibody structure databases like AbDb, which collects information on antibody Fv regions from the Protein Data Bank (PDB) .

How do researchers distinguish between different DEG protease family members?

The DEG protease family includes multiple members (DEG1, DEG2, DEG5, etc.) with distinct subcellular localizations and functions. Researchers must carefully select antibodies with verified specificity to avoid cross-reactivity between family members. The table below summarizes key differences between three DEG proteases:

ProteaseAlternative NamesCellular LocalizationGene IdentifierKey Functions
DEG1DEGP1, DegP protease 1Chloroplastic (thylakoid lumen)At3g27925D1 protein degradation, general lumenal protease
DEG2DEGP2, DegP protease 2, EMB3117Chloroplastic-Embryo development (EMBRYO DEFECTIVE 3117)
DEG5DEGP5, HHOA, PROTEASE HHOA PRECURSORChloroplasticAt4g18370-

Verification of antibody specificity through Western blot analysis with appropriate positive and negative controls is essential before proceeding with experimental applications .

What are the validated experimental applications for DEG-1 antibodies?

DEG-1 antibodies have been validated for several key research applications:

  • Western Blot (WB): The primary application for DEG-1 antibodies is detection of the protease in plant tissue extracts. This method allows researchers to quantify relative abundance of the protease across different experimental conditions .

  • Enzyme-Linked Immunosorbent Assay (ELISA): DEG-1 antibodies can be utilized in ELISA-based detection systems to quantify DEG-1 levels in purified samples or crude extracts .

  • Immunolocalization: Though not explicitly mentioned in the search results, antibodies against chloroplastic proteins are commonly used for subcellular localization studies in plant cells.

When selecting a DEG-1 antibody for experimental applications, researchers should verify the validated applications for their specific antibody preparation, as antibody performance can vary significantly between applications .

What methodological considerations are critical for successful DEG-1 antibody experiments?

When working with DEG-1 antibodies, researchers should consider:

  • Sample preparation: Chloroplast isolation or total protein extraction protocols must preserve DEG-1 structure and prevent proteolytic degradation.

  • Antibody dilution optimization: Each new antibody lot should undergo titration experiments to determine optimal working concentrations for specific applications.

  • Controls: Include positive controls (tissues known to express DEG-1), negative controls (deg1 mutant tissues when available), and loading controls for quantitative analyses.

  • Storage and handling: DEG-1 antibodies should be stored according to manufacturer recommendations. For lyophilized preparations, use a manual defrost freezer and avoid repeated freeze-thaw cycles .

  • Cross-reactivity assessment: Verify species cross-reactivity before applying antibodies to non-model organisms. The DEG-1 antibody has demonstrated cross-reactivity with multiple plant species including Arabidopsis thaliana, Brassica species, rice, maize, and numerous other crop species .

How can DEG-1 antibodies be employed to study photosynthetic stress responses?

DEG-1 antibodies can be powerful tools for investigating photosynthetic stress responses:

  • Photoinhibition studies: Monitor DEG-1 abundance and activation under high light stress conditions to correlate with D1 protein degradation rates.

  • Thylakoid protein turnover: Use DEG-1 antibodies in combination with D1 antibodies to establish temporal relationships between protease abundance and substrate degradation.

  • N6-methyladenosine RNA modification pathways: Recent research has connected DEG-1 to RNA modification processes that regulate photosynthesis during photodamage, providing a novel research direction that can be explored using DEG-1 antibodies .

Experimental design should include time-course analyses following stress application, alongside appropriate controls for normal growth conditions. Protein samples should be collected at strategically timed intervals to capture the dynamic relationship between stress induction, DEG-1 expression, and substrate degradation.

How might rational design principles be applied to develop improved DEG-1-specific antibodies?

Rational antibody design approaches could significantly enhance DEG-1 antibody specificity and performance. Based on principles described in the literature, researchers might:

  • Identify disordered epitope regions specific to DEG-1 that distinguish it from other DEG family members, as disordered protein regions often make excellent antibody epitopes .

  • Design complementary peptides that specifically bind these target regions, using computational approaches to optimize binding affinity and specificity .

  • Graft these complementary peptides onto the complementarity-determining regions (CDRs) of stable antibody scaffolds, particularly focusing on the third CDR (CDR3) loop, which is often tolerant to insertions .

  • Validate the designed antibodies through structural integrity assessment using circular dichroism spectroscopy and binding specificity through ELISA and other binding assays .

This approach has been successful for generating antibodies against intrinsically disordered proteins like Aβ peptide, α-synuclein, and islet amyloid polypeptide , suggesting it could be applied to develop highly specific antibodies distinguishing between DEG protease family members.

What are common issues when working with DEG-1 antibodies and how can they be resolved?

Common challenges when working with DEG-1 antibodies include:

  • Weak signal detection: This may be addressed by:

    • Increasing antibody concentration

    • Extending incubation times

    • Using enhanced detection systems

    • Optimizing protein extraction protocols to preserve the native epitope

  • Background or non-specific binding: Strategies to reduce background include:

    • Increasing blocking agent concentration

    • Extending blocking time

    • Additional washing steps

    • Pre-adsorbing the antibody with non-specific proteins

  • Cross-reactivity with other DEG proteases: Researchers should:

    • Verify antibody specificity using recombinant DEG proteins

    • Include appropriate knockout/knockdown controls

    • Consider using multiple antibodies targeting different epitopes to confirm results

How can researchers verify DEG-1 antibody quality and specificity?

Quality control for DEG-1 antibodies should include:

  • Western blot validation: Confirm the antibody detects a protein of the expected molecular weight (approximately 43 kDa for mature DEG-1) in wild-type samples but not in deg1 mutant samples.

  • Cross-reactivity assessment: Test the antibody against recombinant versions of other DEG family members to ensure specificity.

  • Lot-to-lot consistency: Compare new antibody lots with previously validated lots using standardized samples.

  • Positive controls: Include samples from tissues known to express high levels of DEG-1, such as photosynthetically active leaf tissues.

How might DEG-1 antibodies contribute to understanding chloroplast proteostasis networks?

DEG-1 antibodies can facilitate investigations into broader chloroplast proteostasis networks:

  • Protease activation mechanisms: Study how DEG-1 transitions between inactive and active states during stress conditions.

  • Substrate specificity profiling: Identify novel DEG-1 substrates through co-immunoprecipitation studies followed by mass spectrometry.

  • Protein quality control systems: Investigate how DEG-1 coordinates with other chloroplast proteases and chaperones to maintain protein homeostasis.

  • RNA modification regulation: Explore the newly identified connection between DEG-1 and N6-methyladenosine RNA modification pathways that regulate photosynthesis during photodamage .

These research directions would benefit from combining DEG-1 antibodies with other molecular tools, such as fluorescently tagged proteins, inducible expression systems, and high-resolution microscopy techniques.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.