hsd17b12b Antibody

What is HSD17B12 and why is it significant in research?

HSD17B12 (Hydroxysteroid 17-beta dehydrogenase 12) is a multifunctional enzyme that plays critical roles in both steroid hormone metabolism and fatty acid biosynthesis. It functions in the conversion of estrone to estradiol (E2) and is essential for the elongation of long-chain fatty acids, particularly the conversion of palmitic to arachidonic acid, which serves as a precursor for sterols and the inflammatory mediator prostaglandin E2 .

The significance of HSD17B12 in research stems from its dual functionality and disease implications:

• Cancer research: Overexpression of HSD17B12 together with COX-2 in breast carcinoma is associated with poor prognosis

• Stem cell biology: HSD17B12 plays a positive role in controlling keratinocyte stem cell potential

• Metabolic pathways: As a key enzyme in fatty acid elongation, it's important in lipid metabolism studies

• Alzheimer's disease: HSD17B12 has been detected in neurons of Alzheimer's brain tissue

Research has shown that HSD17B12 knockdown-induced growth inhibition can be reversed by different factors depending on the cell type - arachidonic acid in breast carcinoma cell lines, and both estradiol and arachidonic acid in squamous cell carcinoma of the head and neck .

What are the optimal applications for HSD17B12 antibodies in research?

HSD17B12 antibodies have been successfully employed in various experimental applications, with different antibodies showing application-specific optimization. The most common applications include:

The choice of application should be guided by the specific research question. For instance:

• Use WB for protein expression level comparisons across different samples

• Use IHC-P for tissue localization studies and protein distribution patterns

• Use ICC for subcellular localization studies, which has revealed a particulate perinuclear distribution of HSD17B12 that does not overlap with mitochondria

When selecting an antibody for a specific application, researchers should review the validation data provided by manufacturers for that particular application to ensure optimal results.

How should researchers validate HSD17B12 antibodies for experimental use?

Antibody validation is crucial for ensuring specific and reproducible results. For HSD17B12 antibodies, a multi-pillar validation approach is recommended:

Validation Strategies:

• Genetic Knockdown Validation

  • Use siRNA targeting HSD17B12 in appropriate cell lines (e.g., U-2 OS)

  • Verify reduced signal intensity by Western blot after knockdown

  • At least 25% reduction in target protein expression should be observed

• Orthogonal Validation

  • Compare antibody detection with RNA expression levels

  • Calculate Pearson correlation across multiple cell lines

  • A correlation coefficient >0.5 indicates good validation

• Recombinant Expression Validation

  • Overexpress HSD17B12 in a cell line (e.g., HEK 293)

  • Compare Western blot signals between transfected and control cells

  • Strong band should be present in transfected cells with little or no signal in control cells

• Independent Antibody Validation

  • Test multiple antibodies targeting different epitopes of HSD17B12

  • Compare staining patterns across applications

  • Consistent results across antibodies suggest specificity

• Mass Spectrometry Validation

  • Use immunoprecipitation followed by mass spectrometry

  • Confirm identity of the pulled-down protein as HSD17B12

Example validation data: "Detection of Human 17 beta-HSD1/HSD17B1 by Western Blot showed lysates of human placenta tissue with a specific band detected at approximately 35 kDa. Similar results were observed using Simple Western, with detection at approximately 40 kDa in human placenta lysates" .

The enhanced validation helps ensure that your antibody is detecting the intended target in your specific experimental context, reducing the risk of irreproducible results that have contributed to the "reproducibility crisis" in research .

What common technical challenges arise when using HSD17B12 antibodies in Western blotting?

Researchers frequently encounter several technical challenges when using HSD17B12 antibodies in Western blotting experiments:

Common Challenges and Solutions:

• Variable molecular weight detection

  • Issue: HSD17B12 has been reported at both 35 kDa and 40 kDa in Western blots

  • Solution: Include positive control lysates (e.g., human placenta) with known band pattern; consider post-translational modifications that may alter migration

• Nonspecific bands

  • Issue: Some HSD17B12 antibodies may detect nonspecific proteins

  • Solution: Optimize antibody dilution (typically 1:500-2000); increase blocking time/concentration; use antigen-specific affinity-purified antibodies

• Weak signal intensity

  • Issue: Low expression levels in certain cell types

  • Solution: Load more protein (40 μg/lane recommended) ; optimize exposure time; use enhanced chemiluminescence detection

• Background issues

  • Issue: High background obscuring specific bands

  • Solution: Use Immunoblot Buffer Group 1 under reducing conditions ; increase washing steps; optimize secondary antibody dilution (1:8000 recommended)

• Inconsistent results between experiments

  • Issue: Batch-to-batch variability in antibodies

  • Solution: Maintain consistent experimental conditions; document lot numbers; validate each new lot

For optimal results in detecting HSD17B12 by Western blot, researchers have successfully used the following protocol:

• 8% SDS-PAGE gel

• 40 μg protein per lane

• Primary antibody dilution of 1:570

• HRP-conjugated secondary antibody at 1:8000

• 30-second exposure time

What are the critical considerations for immunohistochemical detection of HSD17B12?

Immunohistochemical detection of HSD17B12 requires attention to several critical factors to ensure specific and reproducible staining:

Protocol Optimization:

• Antigen Retrieval Method

  • Heat-induced epitope retrieval in citrate buffer (pH 6.0) is typically effective

  • Some epitopes may require alternative buffers (EDTA, pH 9.0)

• Antibody Concentration

  • Starting dilution of 1:50-1:200 for most commercial antibodies

  • Titration experiments are recommended for each new tissue type

• Incubation Conditions

  • Optimal results observed with 1-hour incubation at room temperature

  • Overnight incubation at 4°C may improve sensitivity for low-expressed targets

• Detection Systems

  • HRP-polymer detection systems (e.g., Anti-Sheep IgG VisUCyte™ HRP Polymer) provide enhanced sensitivity

  • DAB (3,3'-diaminobenzidine) as chromogen with hematoxylin counterstain

Tissue-Specific Considerations:

HSD17B12 shows distinct localization patterns across tissues:

• Alzheimer's brain: Cytoplasmic staining in neurons

• Placenta: Strong expression useful as positive control

• Cancer tissues: Expression patterns may vary based on cancer type

Example protocol from successful staining: "17 beta-HSD1/HSD17B1 was detected in immersion fixed paraffin-embedded sections of human Alzheimer's brain using Sheep Anti-Human 17 beta-HSD1/HSD17B1 Antigen Affinity-purified Polyclonal Antibody at 10 μg/mL for 1 hour at room temperature followed by incubation with Anti-Sheep IgG VisUCyte™ HRP Polymer Antibody. Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in neurons."

How can researchers determine the ideal epitope region for HSD17B12 antibody selection?

Selecting antibodies targeting appropriate epitopes is crucial for experimental success. For HSD17B12, multiple epitope regions have been used for antibody generation, each with specific advantages:

Epitope Region Analysis:

• N-terminal Region (AA 1-40)

  • Advantages: Less conserved across species, potentially higher specificity

  • Limitations: May be inaccessible in folded protein

• Central Region (AA 126-155)

  • Advantages: Shown to produce antibodies with good immunoreactivity in multiple applications

  • Applications: Successfully used in WB, IHC, and ELISA

• Mid-Region (AA 114-122)

  • Contains the IYDKIKTGL sequence identified as an HLA-A*0201-restricted CD8+ T-cell-defined epitope

  • Important for immunological studies and potential cancer vaccine development

• C-terminal Region (AA 203-271)

  • Used for monoclonal antibody production (e.g., clone 4G11)

  • Good for applications requiring high specificity

Selection Strategy:

For optimal epitope selection, researchers should consider:

• Structural accessibility: Choose regions that are likely exposed in the native protein

• Sequence conservation: Compare human HSD17B12 with orthologs if cross-reactivity is desired

• Post-translational modifications: Avoid regions with potential phosphorylation or glycosylation sites

• Functional domains: The NADP binding site (AA 10-38) and steroid catalytic site (AA 210-221) are important for function

An example of effective epitope selection is demonstrated by the antibody generated against the synthetic peptide between AA 126-155 from the central region of human HSD17B12, which has shown reliable detection in multiple applications .

What approaches can resolve inconsistent results between Western blot and immunohistochemistry when using HSD17B12 antibodies?

Researchers sometimes encounter discrepancies between Western blot (WB) and immunohistochemistry (IHC) results when using the same HSD17B12 antibody. These inconsistencies can be addressed through systematic troubleshooting:

Causes of Inconsistency and Resolution Strategies:

• Different protein conformations

  • Issue: In WB, proteins are denatured, while in IHC, proteins maintain more native conformation

  • Solution: Use antibodies targeting linear epitopes for WB and conformational epitopes for IHC, or validate the same antibody separately for each application

• Sample preparation differences

  • Issue: Fixation in IHC can mask epitopes; extraction methods in WB may affect protein integrity

  • Solution: Optimize antigen retrieval for IHC; test different lysis buffers for WB

• Expression level threshold differences

  • Issue: WB may detect total protein while IHC shows localized expression

  • Solution: Compare results using quantitative methods; use orthogonal validation approaches

• Cross-reactivity profiles

  • Issue: Different cross-reactive proteins may be present in WB versus IHC formats

  • Solution: Use genetic knockdown controls in both applications to confirm specificity

Validation Approach:

When faced with discrepancies, implement this systematic validation workflow:

• Multi-application validation: Validate the antibody independently for each application

• Multiple antibody approach: Use different antibodies targeting distinct epitopes

• Correlation analysis: Compare results with mRNA expression data

• Genetic approach: Use siRNA knockdown or overexpression in both applications

Example from literature: A study showed that while some antibodies performed well in Western blot detection of HSD17B12 at the expected molecular weight of ~35-40 kDa, they failed to show specific staining in IHC. The researchers resolved this by switching to an antibody specifically validated for IHC applications, resulting in the expected cytoplasmic staining pattern in neurons .

How does HSD17B12 expression vary across tissue types and what implications does this have for antibody selection?

Understanding tissue-specific expression patterns of HSD17B12 is crucial for experimental design and antibody selection:

Tissue Expression Profile:

Implications for Antibody Selection:

• Sensitivity requirements:

  • For low-expressing tissues: Choose high-affinity antibodies; consider signal amplification methods

  • For high-expressing tissues: Antibody dilution may need optimization to prevent oversaturation

• Specificity considerations:

  • Cross-reactivity risk varies by tissue type due to expression of related proteins

  • Use tissue-specific validation data when available

• Background issues:

  • Tissues with high lipid content may show increased background with certain antibodies

  • Blocking protocols may need tissue-specific optimization

• Epitope accessibility:

  • The particulate perinuclear distribution observed in keratinocytes suggests specific subcellular localization

  • Antibodies targeting different epitopes may vary in their ability to detect this localized expression

• Ancestry considerations:

  • Higher HSD17B12 expression has been observed in keratinocytes from Black versus White donors

  • This may require adjustment of antibody concentration based on sample origin

When selecting antibodies for specific tissue types, review validation data in similar tissues and consider preliminary titration experiments to determine optimal conditions for your specific samples.

What role does HSD17B12 play in cancer research and how are antibodies utilized in this context?

HSD17B12 has emerged as an important factor in cancer biology, with specific implications for research methodologies and therapeutic development:

Cancer Research Applications:

• Prognostic Marker Studies

  • HSD17B12 overexpression correlates with poor survival in HNSCC patients

  • Kaplan-Meier curve analysis shows strong positive association between elevated HSD17B12 expression and poor prognosis in both male and female patients

  • Antibodies are used for IHC scoring of tumor tissues to correlate with clinical outcomes

• Functional Studies in Cancer

  • Lentivirus-mediated overexpression and gene silencing approaches demonstrate that HSD17B12 enhances clonogenicity and proliferation of skin and head/neck SCC cell lines

  • Western blot with anti-HSD17B12 antibodies confirms expression changes in these experimental models

• Metabolic Pathway Analysis

  • HSD17B12 expression correlates with genes related to cellular metabolic processes and mitochondrial compartments

  • Antibodies help map protein-protein interactions in these pathways

• Immunotherapeutic Target Identification

  • The HSD17B12(114-122) peptide (IYDKIKTGL) has been identified as a naturally presented HLA-A*0201-restricted CD8+ T-cell-defined epitope

  • This discovery provides a basis for developing cancer vaccines targeting HSD17B12

• Ancestry-Related Expression Differences

  • HSD17B12 shows significantly higher expression in HNSCC samples of Black African versus Caucasian origin

  • Antibody-based detection methods help quantify these differences

Methodological Considerations:

For cancer researchers utilizing HSD17B12 antibodies:

• Tissue microarray analysis: Use standardized IHC protocols with antibody dilution of 1:100-1:200

• Cell line studies: Western blot detection typically requires 40μg protein/lane

• siRNA validation: Confirm knockdown efficiency with antibodies showing minimal cross-reactivity

• Subcellular localization: Immunofluorescence reveals particulate perinuclear distribution non-overlapping with mitochondria

An important finding for therapeutic targeting: "Growth inhibition of a breast carcinoma cell line induced by HSD17B12 knockdown was only reversed by AA, while growth inhibition of the SCCHN PCI-13 cell line by HSD17B12 knockdown was reversed by both E2 and AA" - suggesting tissue-specific functions that may inform targeted therapy approaches.

How can researchers troubleshoot weak or non-specific signals when using HSD17B12 antibodies?

When faced with weak or non-specific signals in HSD17B12 antibody applications, researchers can implement the following targeted troubleshooting strategies:

For Western Blotting:

• Weak signal issues:

  • Increase protein loading (40μg/lane recommended)

  • Reduce antibody dilution (try 1:500 if using 1:1000)

  • Extend primary antibody incubation time to overnight at 4°C

  • Use enhanced chemiluminescence detection systems

  • Ensure transfer efficiency with reversible protein stains

• Non-specific bands:

  • Optimize blocking (5% non-fat milk or BSA for 1-2 hours)

  • Increase wash duration and frequency

  • Use antigen-affinity purified antibodies

  • Test reducing and non-reducing conditions (reducing conditions recommended)

  • Use gradient gels to better resolve proteins of similar molecular weight

For Immunohistochemistry:

• Weak or absent staining:

  • Test multiple antigen retrieval methods (citrate vs. EDTA buffers)

  • Increase antibody concentration (start with 1:50 dilution)

  • Extend incubation time to overnight at 4°C

  • Use polymer-based detection systems for signal amplification

  • Consider tissue-specific optimization (e.g., different fixation protocols)

• High background or non-specific staining:

  • Increase blocking time and concentration

  • Include protein blockers (e.g., normal serum)

  • Optimize antibody dilution with titration experiments

  • Include additional washing steps

  • Use more specific secondary antibodies

General Optimization Strategies:

• Antibody validation approach:

  • Test multiple antibodies targeting different epitopes of HSD17B12

  • Validate with positive controls (e.g., human placenta tissue)

  • Include negative controls (e.g., isotype controls, no primary antibody)

• Sample quality assessment:

  • Verify protein integrity with total protein stains

  • Check RNA expression of HSD17B12 in your samples

  • Consider fresh sample preparation

• Cross-reactivity minimization:

  • Pre-absorb antibodies against potential cross-reactive proteins

  • Use monoclonal antibodies for higher specificity

  • Confirm results with orthogonal detection methods

Example: "Detection of Human 17 beta-HSD1/HSD17B1 by Western Blot showed lysates of human placenta tissue. PVDF membrane was probed with 0.2 µg/mL of Sheep Anti-Human 17 beta-HSD1/HSD17B1 Antigen Affinity-purified Polyclonal Antibody followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1."

What is the significance of genetic knockdown validation for HSD17B12 antibodies?

Genetic knockdown validation represents one of the most rigorous approaches for confirming antibody specificity and is particularly valuable for HSD17B12 research:

Methodology and Significance:

• Experimental Design

  • siRNA-mediated knockdown in appropriate cell lines (e.g., U-2 OS)

  • Use of at least two independent siRNA reagents targeting different regions of HSD17B12 mRNA

  • Western blot comparison of control vs. knockdown samples

  • Verification of at least 25% reduction in target protein levels

• Advantages of Genetic Validation

  • Provides direct evidence of antibody specificity to the target protein

  • Controls for potential cross-reactivity with related proteins

  • Helps establish the molecular weight of the true target

  • Enables identification of non-specific bands

• Implementation in HSD17B12 Research

  • Example from literature: "We performed a genetic knockdown using gene-specific siRNA reagents in the cell line U-2 OS for all antibodies evaluated using the TMT-based proteomics analysis, including the set of 14 antibodies with less than fivefold change expression."

  • Results confirmed antibody specificity even in cases where other validation methods were inconclusive

• Integration with Other Validation Methods

  • Complementary to orthogonal validation approaches

  • More definitive than correlation-based methods for antibodies where target proteins show low variability of expression

  • The research showed genetic knockdown validated antibodies that failed RNA correlation-based methods due to low variability

Practical Guidelines:

When implementing genetic knockdown validation:

• Select cell lines with detectable baseline expression of HSD17B12

• Design experiments with appropriate controls (scrambled siRNA, mock transfection)

• Optimize transfection conditions for your specific cell type

• Verify knockdown efficiency at both mRNA (RT-qPCR) and protein (Western blot) levels

• Quantify band intensity reduction using densitometry

• Accept validation if at least one siRNA reagent produces >25% reduction in signal

This approach is particularly valuable for HSD17B12 antibodies given the enzyme's involvement in multiple cellular pathways and potential structural similarity to other hydroxysteroid dehydrogenase family members.

How does HSD17B12 antibody selection impact subcellular localization studies?

The choice of HSD17B12 antibody can significantly influence subcellular localization findings, with important implications for functional studies:

Subcellular Distribution Patterns:

Research has revealed specific localization patterns for HSD17B12:

• Particulate perinuclear distribution: Observed in keratinocytes, non-overlapping with mitochondria

• Cytoplasmic distribution: Observed in neurons of Alzheimer's brain tissue

• Endoplasmic reticulum association: Consistent with its role in fatty acid elongation

Antibody Selection Factors:

• Epitope accessibility in fixed samples

  • Certain epitopes may be masked during fixation procedures

  • Antibodies targeting different regions may produce varying localization patterns

  • Compare multiple antibodies targeting different epitopes to confirm localization

• Fixation and permeabilization compatibility

  • Formaldehyde fixation may preserve structure but can mask epitopes

  • Methanol fixation may better expose certain epitopes but alter membrane structures

  • Test multiple fixation protocols with each antibody

• Cross-reactivity with related proteins

  • Family members may localize to different subcellular compartments

  • Validate specificity with knockdown or knockout approaches

• Antibody format considerations

  • Primary antibody species should be compatible with available secondary antibodies

  • For co-localization studies, antibody species must allow multiplexing

Methodology Recommendations:

For accurate subcellular localization studies:

• Validate with multiple approaches:

  • Combine immunofluorescence with subcellular fractionation followed by Western blot

  • Use co-localization with known organelle markers

  • Consider super-resolution microscopy for precise localization

• Optimized immunofluorescence protocol:

  • Fixation: 4% paraformaldehyde for 15 minutes at room temperature

  • Permeabilization: 0.1% Triton X-100 for 10 minutes

  • Blocking: 5% normal serum from secondary antibody species

  • Primary antibody: Incubate at 1:100-1:200 dilution overnight at 4°C

  • Secondary antibody: Fluorophore-conjugated antibodies at 1:500, 1 hour at room temperature

  • Counterstain: DAPI for nuclear visualization

  • Mounting: Anti-fade mounting medium to preserve fluorescence

• Controls for validation:

  • Peptide competition to confirm specificity

  • siRNA knockdown to verify signal reduction

  • Omission of primary antibody to assess background

The unique particulate perinuclear distribution of HSD17B12 "non-overlapping with mitochondria" observed in keratinocytes highlights the importance of careful antibody selection and validation for accurate subcellular localization studies.

What guidelines should researchers follow when interpreting Western blot results with HSD17B12 antibodies?

Accurate interpretation of Western blot results with HSD17B12 antibodies requires careful attention to several key factors:

Interpretation Guidelines:

• Expected molecular weight verification

  • HSD17B12 typically appears at 34-40 kDa on Western blots

  • Variations in observed molecular weight may occur due to:

    • Post-translational modifications

    • Alternative splicing

    • Sample preparation differences

    • Gel percentage and running conditions

• Band pattern analysis

  • Clean, single band at expected molecular weight suggests specificity

  • Multiple bands may indicate:

    • Isoforms or splice variants

    • Degradation products

    • Post-translational modifications

    • Cross-reactivity with related proteins

• Quantitative considerations

  • For expression level comparisons:

    • Normalize to appropriate loading controls (β-actin, GAPDH)

    • Use densitometry with linear range verification

    • Include standard curves with known quantities when possible

• Positive and negative controls

  • Human placenta tissue lysate serves as a reliable positive control

  • Cell lines with validated high expression: A375, HeLa, A172

  • Genetic knockdown samples provide excellent negative controls

Common Pitfalls and Solutions:

• Non-specific bands

  • Issue: Extra bands at unexpected molecular weights

  • Solution: Increase antibody specificity by using affinity-purified antibodies; optimize blocking and washing steps

• Variable results between experiments

  • Issue: Inconsistent band patterns or intensities

  • Solution: Standardize sample preparation, loading amounts, and exposure times; document antibody lot numbers

• Background issues

  • Issue: High background obscuring bands

  • Solution: Use Immunoblot Buffer Group 1 under reducing conditions ; increase washing time and frequency

• Contradictory results between antibodies

  • Issue: Different antibodies show different patterns

  • Solution: Validate with orthogonal methods; prioritize antibodies validated by multiple approaches

Validation Example:

From the literature: "Western blot shows lysates of human placenta tissue. PVDF membrane was probed with 0.2 µg/mL of Sheep Anti-Human 17 beta-HSD1/HSD17B1 Antigen Affinity-purified Polyclonal Antibody followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody. A specific band was detected for 17 beta-HSD1/HSD17B1 at approximately 35 kDa."

For optimal Western blot interpretation, researchers should document all experimental conditions, including gel percentage, protein loading amount, antibody dilutions, exposure times, and lot numbers to ensure reproducibility and facilitate troubleshooting.

How do recently developed validation approaches improve reliability of HSD17B12 antibody-based research?

Recent advances in antibody validation have significantly enhanced the reliability of HSD17B12 antibody-based research through more rigorous and standardized approaches:

Modern Validation Pillars:

• Genetic Validation

  • siRNA knockdown demonstrates specificity by signal reduction

  • Example implementation: "217 antibodies were validated using this method" including HSD17B12 antibodies

  • Provides direct evidence of target specificity even in complex samples

• Orthogonal Validation

  • Compares antibody-based protein detection with RNA-level measurements

  • Pearson correlation >0.5 across multiple cell lines indicates validation

  • Success depends on RNA-protein correlation and expression variability

• Independent Antibody Validation

  • Tests multiple antibodies recognizing different epitopes

  • Concordant results increase confidence in specificity

  • Example: "Several examples are shown in Supplementary Fig. 7 and altogether 217 antibodies were validated using this method"

• Recombinant Expression Validation

  • Overexpresses target protein in cell lines

  • Measures increased signal with antibody

  • "2,190 antibody targets were validated using this method"

• MS-based Validation

  • Uses mass spectrometry to confirm identity of detected proteins

  • Especially valuable for confirming antibody specificity in immunoprecipitation

Implementation Benefits:

• Standardized reporting

  • Enhanced validation status clearly indicated in product documentation

  • Example: "The enhanced validation is specific for a certain sample context and the validation is thus dependent on the sample preparation procedures"

• Application-specific validation

  • Validation performed for specific applications (WB, IHC, ICC)

  • Prevents misapplication of antibodies validated for different techniques

• Quantifiable validation metrics

  • Correlation coefficients provide objective measure of antibody performance

  • Threshold requirements (e.g., >25% knockdown, >0.5 correlation) ensure minimum quality standards

• Multi-pillar approach power

  • "1,630 antibodies were validated by at least two of the pillars and 267 were validated by three or more pillars"

  • Multiple validation methods provide stronger evidence of specificity

Practical Implementation for HSD17B12 Research:

Researchers working with HSD17B12 antibodies should:

• Select antibodies validated by multiple pillars when available

• Implement at least one validation method in their own experimental system

• Report validation methods and results in publications

• Consider the specific sample context of previous validations

• Document antibody performance metrics across experiments

This multi-faceted validation approach has transformed antibody-based research from relying on manufacturer claims to implementing verification methods that demonstrably improve reproducibility and reliability of HSD17B12 studies.

What considerations are important when using HSD17B12 antibodies across different species?

Using HSD17B12 antibodies across different species requires careful consideration of sequence homology, epitope conservation, and validation in target species:

Cross-Species Reactivity Analysis:

• Sequence conservation assessment

  • Human HSD17B12 shows approximately 83% sequence identity with mouse and rat orthologs

  • The immunogen sequence WGVGNEAGVGPGLGEWAVVTGSTDGIGKSYAEELAKHGMKVVLISRSKDKLDQVSSEIKEKFKVETRTIAVDFASEDIYDKIKTGLAGLEIGILVNNVGMSYEYPEYFLDVPDLD shows high conservation across mammals

• Epitope-specific considerations

  • Central regions (AA 126-155) tend to be more conserved than terminal regions

  • Most commercially available antibodies are raised against human sequences

  • Some antibodies (e.g., ABIN1859204) are specifically validated for rat reactivity

Species-Specific Validation Approaches:

• Western blot validation

  • Test antibody against lysates from multiple species

  • Compare molecular weights and band patterns

  • Include positive controls from validated species

• Immunohistochemical optimization

  • Tissue-specific fixation protocols may differ between species

  • Antigen retrieval methods may require species-specific adjustment

  • Background levels can vary significantly between species

• Negative controls

  • Use tissue from knockout animals when available

  • siRNA knockdown in species-specific cell lines

  • Competition with immunizing peptide

Practical Recommendations:

When using HSD17B12 antibodies across species:

• Select antibodies with demonstrated cross-reactivity

  • Example: Some antibodies are validated for "Human, Rat, Mouse" reactivity

  • Review sequence alignment of immunogen with target species sequence

• Optimize protocols for each species

  • Test multiple antibody dilutions

  • Adjust blocking reagents to minimize species-specific background

  • Consider longer incubation times for cross-reactive applications

• Include appropriate controls

  • Species-matched positive and negative controls

  • Genetic manipulation controls when possible

  • Orthogonal validation with species-specific reagents

• Consider raising species-specific antibodies

  • For critical research requiring high specificity in non-human species

  • Target unique regions of the species-specific HSD17B12 sequence