DNAJC19 Antibody

What are the most commonly available types of DNAJC19 antibodies and their target epitopes?

Most commercially available DNAJC19 antibodies are polyclonal antibodies raised in rabbits. They target different epitopes:

The immunogen sequences most frequently used include the full-length recombinant protein or specific peptide regions such as "LQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPK" .

What species reactivity should researchers consider when selecting DNAJC19 antibodies?

When selecting DNAJC19 antibodies, consider that most available antibodies demonstrate reactivity to:

• Human DNAJC19 (primary validation)

• Mouse DNAJC19 (frequently cross-reactive)

• Rat DNAJC19 (frequently cross-reactive)

Some antibodies have been reported to cross-react with additional species:

• Rabbit, cow, horse, monkey, pig, and Xenopus laevis

• Zebrafish (Danio rerio), dog, guinea pig, and Saccharomyces cerevisiae

When working with less common experimental models, validation of cross-reactivity is strongly recommended as sequence homology predictions may not always translate to actual antibody binding .

Which applications are most validated for DNAJC19 antibodies?

The most extensively validated applications for DNAJC19 antibodies include:

Most published studies have utilized DNAJC19 antibodies for Western blotting and immunofluorescence applications, with positive detection reported in human cell lines (HeLa, A549, HepG2), tissue samples (brain, lung), and mouse heart tissue .

How should researchers validate DNAJC19 antibody specificity in their experimental systems?

A systematic validation approach for DNAJC19 antibodies should include:

• Knockdown validation: Employing siRNA or shRNA targeting DNAJC19 has been successfully used to confirm antibody specificity. For example, in lung cancer research, shRNA constructs targeting DNAJC19 (GenBank Accession No. NM_145261) using the sequence TTTGCAGGCCGTTACGTTT effectively reduced protein expression detectable by antibodies .

• Overexpression controls: Ectopic expression of DNAJC19 should increase signal intensity in relevant detection methods.

• Molecular weight verification: The expected molecular weight of DNAJC19 is 13 kDa, and antibodies should detect a band at this size in Western blots .

• Tissue/cellular localization: DNAJC19 should primarily localize to mitochondria, particularly the inner mitochondrial membrane.

• Positive control tissues: Human brain tissue, human lung tissue, HeLa cells, and mouse heart tissue have been validated as positive controls for DNAJC19 detection .

• Knockout models: When available, tissues from DNAJC19 knockout models provide the most definitive validation control.

What are the optimal sample preparation methods for DNAJC19 detection?

For optimal DNAJC19 detection:

Western Blotting:

• Use standard SDS-PAGE with 12-15% gels (optimal for low molecular weight proteins)

• Include protease inhibitors in lysis buffers

• Include mitochondrial enrichment steps for enhanced sensitivity

• Transfer to PVDF membranes (preferred over nitrocellulose)

• Use 5% non-fat milk in TBST for blocking

Immunohistochemistry:

• Formalin-fixed, paraffin-embedded tissues work well

• Antigen retrieval is crucial (citrate buffer pH 6.0)

• Dilution ranges of 1:50-1:200 yield optimal results

• Human brain tissue sections show reliable positive staining

Immunofluorescence:

• PFA fixation (4%, 15 minutes)

• Permeabilization with 0.1-0.2% Triton X-100

• Co-staining with mitochondrial markers (e.g., MitoTracker) validates localization

• HepG2 cells show reliable staining at 1:25-1:100 dilution

How can researchers troubleshoot weak or absent DNAJC19 signal detection?

When experiencing weak or absent DNAJC19 signal:

• For Western blotting:

  • Increase protein loading (25-50 μg total protein)

  • Enrich mitochondrial fraction by differential centrifugation

  • Reduce washing stringency (use 0.05% instead of 0.1% Tween-20)

  • Extend primary antibody incubation (overnight at 4°C)

  • Use enhanced chemiluminescence substrates with longer exposure times

• For immunostaining (IHC/IF):

  • Optimize antigen retrieval (try both heat-mediated and enzymatic methods)

  • Decrease antibody dilution (use more concentrated antibody)

  • Increase primary antibody incubation time (overnight at 4°C)

  • Use signal amplification systems (e.g., HRP-polymer or tyramide signal amplification)

  • Confirm tissue viability and fixation quality

• General considerations:

  • Verify expression levels in your experimental model (DNAJC19 may be tissue/cell-type specific)

  • Check antibody storage conditions (avoid freeze-thaw cycles)

  • Consider alternative antibody clones targeting different epitopes

  • Validate reagents using positive controls (e.g., HeLa cells, human brain tissue)

How can DNAJC19 antibodies be used to investigate mitochondrial protein import mechanisms?

DNAJC19 antibodies are valuable tools for studying mitochondrial protein import through several approaches:

• Co-immunoprecipitation studies:

  • Use anti-DNAJC19 antibodies (4 μg per 3 mg of lysate) to pull down DNAJC19 complexes from mitochondrial extracts

  • Analyze co-precipitated proteins by mass spectrometry or Western blotting

  • This approach has successfully identified interactions with HSP70 chaperones and other components of the protein import machinery

• Proximity labeling approaches:

  • Combine with BioID or APEX2 techniques to identify proximal proteins in the import pathway

  • Validate interactions using reciprocal co-IP with DNAJC19 antibodies

• Subcellular fractionation validation:

  • Use DNAJC19 antibodies to confirm successful isolation of inner mitochondrial membrane fractions

  • Employing IF with DNAJC19 antibodies can validate mitochondrial fractionation protocols

• Import assay monitoring:

  • After in vitro protein import assays, use DNAJC19 antibodies to assess association of imported proteins with the PAM complex

  • Particularly useful when studying mutant variants of DNAJC19 associated with disease states

What is known about DNAJC19's role in cancer and how can antibodies advance this research?

Research using DNAJC19 antibodies has revealed important oncogenic functions:

• Expression in cancer tissues:

  • Immunohistochemical analysis with DNAJC19 antibodies demonstrated higher expression in non-small-cell lung cancer (NSCLC) tumors compared to adjacent non-cancerous tissues

  • Low DNAJC19 levels correlated with increased progression-free survival rates in patients

• Functional pathway analysis:

  • Western blot analysis with DNAJC19 antibodies revealed that DNAJC19 knockdown decreased PI3Kp85α, AKT, and p-AKT expression in A549 lung cancer cells

  • This established a mechanistic link between DNAJC19 and the PI3K/AKT signaling pathway in cancer progression

• Therapeutic targeting studies:

  • Antibody-based detection of DNAJC19 in xenograft models showed that DNAJC19 knockdown markedly inhibited tumor growth and metastasis

  • Immunohistochemical analysis of xenograft tumors confirmed decreased DNAJC19, PI3K, and AKT expression in shDNAJC19-treated groups

• Methodological approaches:

  • Cell-based assays: Use DNAJC19 antibodies to monitor expression levels after siRNA/shRNA knockdown in cancer cell lines

  • Animal models: Employ IHC with DNAJC19 antibodies to assess expression in xenograft and metastasis tumor models

  • Clinical samples: Apply IHC to tissue microarrays to correlate DNAJC19 expression with patient outcomes

How do DNAJC19 mutations affect protein detection and what methodological approaches can address this?

DNAJC19 mutations associated with disease present specific challenges for antibody-based detection:

• Isoform complexity and detection:

  • The DNAJC19 gene consists of three isoforms:

    • Isoform 1: Full-length transcript (525 nt)

    • Isoform 2: Lacking transmembrane domain due to alternative start codon

    • Isoform 3: Lacking DnaJ domain caused by exon 4 deletion (445 nt)

  • The homozygous c.130-1G>C mutation affects splicing, resulting in deletion of exon 4 and exclusive expression of isoform 3

• Methodological approaches for mutation carriers:

  • RT-PCR validation should precede antibody-based studies to confirm which isoforms are expressed

  • Select antibodies targeting epitopes present in the expected isoforms

  • For mutations causing early truncation, N-terminal antibodies are preferred

  • For splice variants, avoid antibodies targeting regions affected by splicing alterations

• Cellular models for studying mutations:

  • iPSC-derived cardiomyocytes from patients with DNAJC19 mutations show altered mitochondrial structure and function

  • When studying such models, combine antibody detection with functional assays to correlate structural changes with functional outcomes

What approaches are recommended for studying DNAJC19 interactions with the prohibitin complex?

To investigate DNAJC19's interactions with prohibitins:

• Co-immunoprecipitation strategies:

  • Use DNAJC19 antibodies for pull-down followed by PHB1/PHB2 detection

  • Reciprocal IP with PHB antibodies followed by DNAJC19 detection

  • Chemical crosslinking prior to IP can stabilize transient interactions

  • Optimize detergent conditions (digitonin or mild non-ionic detergents preserve membranous complexes)

• Proximity labeling techniques:

  • BioID or APEX2 fusions with DNAJC19 can identify proximal proteins including prohibitins

  • Validate proximities with co-localization studies using DNAJC19 and PHB antibodies

• Functional reconstitution:

  • In vitro reconstitution of DNAJC19-PHB complexes using purified components

  • Use antibodies to validate complex formation and stoichiometry

  • Employ antibodies to disrupt specific interfaces and assess functional consequences

• Cardiolipin remodeling assays:

  • Monitor cardiolipin species by mass spectrometry in response to DNAJC19 depletion

  • Use DNAJC19 antibodies to confirm knockdown efficiency

  • Correlate cardiolipin alterations with DNAJC19-PHB complex integrity

How can researchers combine DNAJC19 antibodies with emerging technologies for comprehensive functional studies?

Integration of DNAJC19 antibodies with emerging technologies offers powerful research approaches:

• Super-resolution microscopy:

  • Use fluorescently-labeled DNAJC19 antibodies for STORM or STED microscopy

  • Resolve submitochondrial localization with precision beyond conventional microscopy

  • Combine with PHB or cardiolipin markers for co-localization studies at nanoscale resolution

• CRISPR-based approaches:

  • Generate DNAJC19 knockout/knockin cell lines via CRISPR-Cas9

  • Validate editing efficiency using DNAJC19 antibodies

  • Create epitope-tagged versions for pull-down studies while monitoring native function

• Single-cell proteomics:

  • Apply DNAJC19 antibodies in single-cell Western blotting

  • Correlate DNAJC19 levels with mitochondrial function at single-cell resolution

  • Identify cellular heterogeneity in response to metabolic stressors

• Spatial transcriptomics correlation:

  • Combine DNAJC19 antibody staining with spatial transcriptomics

  • Correlate protein localization with local transcriptional responses

  • Particularly valuable in tissue contexts (heart, brain) where DNAJC19 mutations cause pathology

What methodological approaches are recommended for studying DNAJC19 in the context of dilated cardiomyopathy?

For investigating DNAJC19's role in dilated cardiomyopathy (DCM):

• Patient-derived iPSC-cardiomyocyte models:

  • Generate cardiomyocytes from iPSCs derived from DCMA patients (carrying DNAJC19 mutations)

  • Use DNAJC19 antibodies to confirm protein expression patterns

  • Combine with mitochondrial function assays and structural analysis

• Animal models:

  • Cardiac-specific DNAJC19 knockout or mutation knock-in models

  • Validate models using DNAJC19 antibodies for expression analysis

  • Correlate functional cardiac phenotypes with molecular alterations

  • Employ immunohistochemistry to assess tissue-level changes in DNAJC19 and interacting partners

• Therapeutic screening approaches:

  • Use DNAJC19 antibodies to monitor protein levels or localization in response to candidate therapies

  • Develop high-content screening using DNAJC19 antibodies as readout for compound libraries

  • Validate hits using functional recovery of mitochondrial parameters

• Multi-omics integration:

  • Correlate DNAJC19 protein levels (antibody-based detection) with:

    • Lipidomics (especially cardiolipin species)

    • Transcriptomics (compensatory gene expression)

    • Metabolomics (particularly 3-methylglutaconic acid levels)

  • This integrated approach can better define the molecular mechanisms linking DNAJC19 dysfunction to cardiomyopathy

What are the most common technical issues with DNAJC19 antibody applications and their solutions?

Research has shown that DNAJC19 antibody validation using siRNA knockdown is particularly effective for confirming specificity, as demonstrated in multiple studies .

How should researchers interpret discrepancies between different DNAJC19 antibody detection methods?

When facing discrepancies between different detection methods:

• Western blot vs. immunofluorescence discrepancies:

  • Western blot detects denatured protein while IF detects native conformation

  • Epitope accessibility differs between methods

  • Some antibodies may preferentially recognize denatured epitopes

  • Solution: Use antibodies validated for both applications or multiple antibodies against different epitopes

• Transcript vs. protein level inconsistencies:

  • Post-transcriptional regulation may affect protein levels

  • DNAJC19 protein stability may vary in different contexts

  • Solution: Correlate with functional assays of mitochondrial import

• Different antibody clones showing variable results:

  • Different epitopes may be differentially accessible

  • Isoform-specific detection can cause apparent discrepancies

  • Solution: Map the precise epitopes recognized by each antibody

  • Compare with genetic knockdown validation results

• Research strategies to resolve discrepancies:

  • Use complementary methods (e.g., mass spectrometry)

  • Apply genetic models (knockdown/knockout)

  • Consider post-translational modifications

  • Evaluate subcellular fractionation purity when comparing methods