dph-1 Antibody

What is DPH1 and what cellular functions does it regulate?

DPH1 (Diphthamide biosynthesis 1) is a DNA-binding protein primarily involved in catalyzing the first step of diphthamide biosynthesis, a post-translational modification of histidine in elongation factor 2 (eEF2). This modification is essential for eEF2 function in protein synthesis. Beyond this primary role, DPH1 participates in neural development, synaptic plasticity, cognitive function, cell cycle regulation, and exhibits both tumor-suppressive and oncogenic activities depending on the cellular context. DPH1 is expressed in multiple tissues including heart, brain, placenta, lung, liver, skeletal muscle, kidney, and reproductive organs . Its activity is regulated through phosphorylation modifications, with Ser235 and Ser238 being identified as key phosphorylation sites that influence its function .

What are the optimal applications for DPH1 antibodies in experimental research?

DPH1 antibodies are optimally suited for several experimental applications, including immunohistochemistry (IHC), Western blotting (WB), and ELISA. Depending on the specific antibody formulation, they can be applied to detect native DPH1 in tissue samples, cell lysates, and protein extracts. Commercially available antibodies have been validated for human samples, with many showing cross-reactivity with mouse and rat DPH1 proteins due to high sequence homology . For precise subcellular localization studies, FITC-conjugated anti-DPH1 antibodies provide excellent visualization capabilities in immunofluorescence experiments, allowing researchers to track DPH1's distribution between nuclear and cytoplasmic compartments .

How do you validate the specificity of DPH1 antibodies in research applications?

Validating DPH1 antibody specificity requires multiple complementary approaches:

• Positive and negative controls: Use cell lines with known DPH1 expression (such as MCF7 which has confirmed DPH1 expression) versus DPH1 knockout cell lines .

• Peptide competition assay: Pre-incubate the antibody with its specific immunizing peptide (e.g., the synthetic peptide directed toward the middle region of human DPH1 with sequence: RMQAARQEAIATARSAKSWGLILGTLGRQGSPKILEHLESRLRALGLSFV) to confirm signal disappearance .

• Multiple antibody verification: Use antibodies targeting different epitopes of DPH1 to confirm consistency in detection patterns.

• Western blot molecular weight verification: Confirm detection at the expected molecular weight (~48.1 kDa for canonical human DPH1) .

• siRNA knockdown: Compare antibody signal in cells with and without DPH1 knockdown to confirm specificity.

What is the optimal protocol for using DPH1 antibodies in Western blotting of tumor samples?

Optimized Western Blot Protocol for DPH1 Detection in Tumor Samples:

• Sample preparation:

  • Extract proteins from fresh or frozen tumor tissue using RIPA buffer supplemented with protease and phosphatase inhibitors

  • Determine protein concentration using BCA or Bradford assay

  • Load 20-50 μg protein per lane

• Separation and transfer:

  • Use 10% SDS-PAGE for optimal separation

  • Transfer proteins to PVDF membrane (preferable over nitrocellulose for DPH1)

  • Confirm transfer efficiency with Ponceau S staining

• Blocking and antibody incubation:

  • Block membrane with 5% non-fat milk in TBST for 1 hour at room temperature

  • Incubate with primary DPH1 antibody (1:500-1:1000 dilution) overnight at 4°C

  • Wash thoroughly with TBST (3 × 10 minutes)

  • Incubate with HRP-conjugated secondary antibody (1:5000) for 1 hour at room temperature

• Detection and analysis:

  • Develop using ECL substrate

  • Expected band: 48.1 kDa for full-length human DPH1

  • Use β-actin or GAPDH as loading control

  • Quantify using densitometry software, normalizing to loading control

This protocol has been optimized based on studies investigating DPH1's role in colorectal cancer cells and other cancer models. When comparing normal vs. tumor tissue, differential expression of DPH1 can provide insights into its oncogenic or tumor-suppressive roles in specific cancer contexts.

How can DPH1 activity be functionally assessed beyond protein detection?

Functional assessment of DPH1 goes beyond simple protein detection and requires specialized assays:

• Diphtheria Toxin ADP-Ribosylation (ADPR) Assay: This is the gold standard for assessing DPH1 functionality. The assay measures the ability of DPH1 to catalyze the first step in diphthamide modification of eEF2 by:

  • Preparing cell lysates from test and control cells

  • Incubating with diphtheria toxin and biotinylated NAD+

  • Detecting ADP-ribosylated eEF2 via Western blot or ELISA

  • The level of ADP-ribosylation directly correlates with DPH1 activity

• Molecular Dynamics Simulations: Using homology models of the DPH1-DPH2 heterodimer to assess how mutations affect:

  • Catalytic site accessibility

  • Protein-protein interactions

  • Structural stability

• Cell Proliferation and Invasion Assays: Compare cell behaviors under DPH1 silencing or overexpression conditions using:

  • MTT/XTT viability assays

  • Transwell invasion assays

  • Colony formation assays

• miRNA Regulatory Analysis: Assess the regulation of DPH1 by miR-218-5p using:

  • Luciferase reporter assays with wild-type and mutant DPH1 3'UTR constructs

  • qRT-PCR to confirm inverse correlation between miRNA and DPH1 expression

These functional assessments provide deeper insights into DPH1's biological roles than antibody-based detection alone.

What methodological considerations are important when using DPH1 antibodies in immunohistochemistry?

Key Methodological Considerations for DPH1 IHC:

• Tissue Preparation and Fixation:

  • Formalin fixation time significantly affects DPH1 epitope preservation (optimal: 24 hours)

  • Paraffin-embedded sections work better than frozen sections for consistent DPH1 staining

  • 4-5 μm section thickness provides optimal results

• Antigen Retrieval:

  • Heat-induced epitope retrieval using citrate buffer (pH 6.0) for 20 minutes is recommended

  • Pressure cooker methods yield more consistent results than microwave methods

• Antibody Selection and Dilution:

  • Test multiple antibody dilutions (starting range: 1:100 to 1:500)

  • For human ovarian cancer tissues, 1:100 dilution has shown optimal results

  • Include positive control tissues (MCF7 cell blocks) in each staining run

• Signal Detection Considerations:

  • DPH1 shows both nuclear and cytoplasmic localization; evaluate both compartments

  • Use appropriate counterstains that don't obscure DPH1 signal

  • For fluorescent detection, FITC-conjugated antibodies require light protection during all steps

• Quantification Methods:

  • Use established scoring systems (H-score or Allred)

  • Digital image analysis improves reproducibility

  • Record both staining intensity and percentage of positive cells

How can DPH1 antibodies be used to investigate its dual role in cancer progression?

DPH1 exhibits context-dependent oncogenic and tumor-suppressive properties, making it a complex target for cancer research. Strategic antibody-based approaches to investigate this duality include:

• Differential Expression Analysis Across Cancer Types:

  • Implement tissue microarray (TMA) analysis using validated DPH1 antibodies across multiple cancer types

  • Correlate expression with clinical outcomes and molecular subtypes

  • In colorectal cancer, DPH1 appears to function as an oncogene, where its expression positively correlates with proliferation and invasion

  • In ovarian cancer, DPH1 may function as a tumor suppressor (historically known as OVCA1)

• Subcellular Localization Studies:

  • Use high-resolution confocal microscopy with immunofluorescence

  • Implement subcellular fractionation followed by Western blotting

  • Changes in nuclear-to-cytoplasmic ratio of DPH1 may indicate altered function

• Post-translational Modification Assessment:

  • Employ phospho-specific DPH1 antibodies (targeting Ser235 and Ser238)

  • Correlate phosphorylation status with oncogenic or tumor-suppressive behaviors

  • Phosphorylation levels correlate with anti-tumor effect intensity

• Pathway Interaction Analysis:

  • Use co-immunoprecipitation with DPH1 antibodies followed by mass spectrometry

  • Identify differential protein interaction partners in normal vs. cancer cells

  • Investigate the miR-218-5p/DPH1 regulatory axis, which appears important in colorectal carcinogenesis

This multi-faceted approach can reconcile the seemingly contradictory roles of DPH1 in different cancer contexts.

What approaches can be used to study the relationship between DPH1 mutations and neurodevelopmental disorders?

Investigating DPH1's role in neurodevelopmental disorders requires specialized techniques:

• Functional Assessment of DPH1 Variants:

  • Use diphtheria toxin ADP-ribosylation assays to measure the activity of DPH1 variants found in patients

  • Compare activity levels between wild-type and mutant DPH1 proteins

  • Correlate functional impairment with clinical severity

• Structural Modeling and Simulation:

  • Build homology models of DPH1-DPH2 heterodimers

  • Perform molecular dynamics simulations to assess:

    • Changes in catalytic site dimensions

    • Alterations in protein-protein interactions

    • Effects on protein stability

• Genotype-Phenotype Correlation Studies:

  • Comprehensive clinical assessment of patients with DPH1 variants

  • Document severity of developmental delay, dysmorphic features, and other symptoms

  • Correlate with specific mutations and their predicted impact on protein function

• Animal Models and Developmental Studies:

  • Generate DPH1 knockout or knock-in models expressing patient-specific variants

  • Assess neurodevelopmental milestones and brain morphology

  • Use DPH1 antibodies for tissue-specific expression studies during development

This systematic approach enables correlation between molecular dysfunction and clinical presentation in DPH1 syndrome .

How should researchers address inconsistent results when using DPH1 antibodies across different experimental platforms?

When facing inconsistent results with DPH1 antibodies across different experimental platforms, implement the following systematic troubleshooting approach:

• Antibody Validation Assessment:

  • Verify antibody specificity using knockout/knockdown controls

  • Test multiple DPH1 antibodies targeting different epitopes

  • Check lot-to-lot variability by requesting certificate of analysis

• Platform-Specific Optimizations:

  • Western Blot: Adjust protein extraction methods (RIPA vs. NP-40 vs. urea-based buffers)

  • IHC: Modify antigen retrieval (pH, duration, method)

  • IF: Test different fixation methods (paraformaldehyde vs. methanol)

• Protein Modification Considerations:

  • DPH1 undergoes phosphorylation that may affect epitope accessibility

  • Post-translational modifications may vary by cell type or physiological state

  • Consider using phosphatase treatment of samples to normalize modification status

• Data Normalization Strategies:

  • Implement consistent reference genes/proteins across platforms

  • Use recombinant DPH1 protein as positive control and calibrator

  • Apply standardized quantification methods across experiments

• Technical Considerations Table:

By systematically addressing these factors, researchers can identify the source of inconsistencies and develop a robust, reproducible protocol across experimental platforms.

How can contradictory findings about DPH1's role as either an oncogene or tumor suppressor be reconciled through antibody-based experiments?

Reconciling contradictory findings about DPH1's dual role requires sophisticated experimental approaches:

• Context-Dependent Expression Analysis:

  • Use validated DPH1 antibodies to perform comprehensive tissue microarray analysis across multiple cancer types and stages

  • Combine with survival data to correlate expression with outcomes

  • Implement multivariate analysis to identify cofactors that influence DPH1's role

• Protein Interaction Network Mapping:

  • Perform co-immunoprecipitation with DPH1 antibodies followed by mass spectrometry

  • Compare interaction partners between:

    • Cancer types where DPH1 acts as an oncogene (e.g., colorectal cancer)

    • Cancer types where DPH1 acts as a tumor suppressor (e.g., ovarian cancer)

  • Identify context-specific binding partners that may redirect DPH1's function

• Phosphorylation Status Assessment:

  • Generate and validate phospho-specific antibodies for known DPH1 modification sites

  • Compare phosphorylation patterns between cancer types

  • Correlate modifications with functional outcomes (proliferation, invasion)

• Subcellular Localization Studies:

  • Implement high-resolution subcellular fractionation followed by Western blotting

  • Perform quantitative immunofluorescence to determine nuclear/cytoplasmic ratios

  • Correlate localization patterns with oncogenic or tumor-suppressive behaviors

• MicroRNA Regulatory Analysis:

  • Investigate the miR-218-5p/DPH1 regulatory axis across cancer types

  • Determine if differential microRNA expression explains contradictory roles

  • In colorectal cancer, loss of miR-218-5p appears to drive DPH1's oncogenic function

Through this multifaceted approach, researchers can identify the molecular switches that determine whether DPH1 functions as an oncogene or tumor suppressor in specific cellular contexts.

How might DPH1 antibodies be used in novel therapeutic development for neurodevelopmental disorders?

Emerging research applications for DPH1 antibodies in neurodevelopmental disorder therapeutics include:

• Therapeutic Target Validation:

  • Use DPH1 antibodies to confirm target engagement in preclinical models

  • Assess on-target vs. off-target effects of potential therapeutics

  • Monitor DPH1 expression changes during development and in response to interventions

• Patient Stratification Biomarker Development:

  • Develop immunoassays to identify patients with DPH1-related disorders

  • Create a standardized scoring system based on DPH1 functionality

  • Correlate biomarker levels with clinical presentation and potential therapeutic response

• Therapeutic Monitoring Applications:

  • Use DPH1 activity assays based on antibody detection to monitor treatment efficacy

  • Develop point-of-care tests for longitudinal patient monitoring

  • Implement as companion diagnostics for emerging therapies

• Novel Therapeutic Approaches:

  • Develop therapeutic antibodies targeting specific DPH1 conformations

  • Design targeted protein degradation approaches for mutant DPH1

  • Create antisense oligonucleotides to modulate DPH1 expression

These emerging applications leverage DPH1 antibodies beyond their traditional research uses into the therapeutic development pipeline for DPH1 syndrome/DEDSSH and related neurodevelopmental disorders .

What are the methodological considerations for integrating DPH1 antibody detection with diphthamide biosynthesis functional assays?

Integrating antibody detection with functional assessment requires careful methodological planning:

• Sample Preparation Harmonization:

  • Develop unified extraction protocols suitable for both antibody detection and functional assays

  • Optimize lysis conditions that preserve both protein structure and enzymatic activity

  • Create parallel workflow for both analyses from the same sample

• Sequential Analysis Protocol:

  • Perform quantitative Western blot or ELISA for DPH1 protein levels

  • Use remaining lysate for diphtheria toxin ADP-ribosylation assay

  • Plot correlation between protein levels and functional activity

• Multiparametric Analysis Framework:

  • Develop an integrated scoring system combining:

    • DPH1 protein expression level (antibody-based)

    • Diphthamide modification activity (functional)

    • DPH1-DPH2 interaction status (structural)

  • This provides a comprehensive assessment of DPH1 biology

• Technical Validation Approach:

  • Use recombinant DPH1 protein with known activity as calibrator

  • Include wild-type and known mutant controls

  • Calculate activity/protein ratio to normalize for expression differences

• Correlation Matrix Development:

This integrated approach provides comprehensive assessment of DPH1 status, offering deeper insights than either antibody detection or functional assays alone .