DREB1B Antibody

What is DREB1B and why is it significant in plant research?

DREB1B (Dehydration-Responsive Element-Binding protein 1B) is a transcription factor in plants that plays a crucial role in abiotic stress responses, particularly cold and drought tolerance. It belongs to the AP2/ERF (APETALA2/Ethylene Responsive Factor) family of transcription factors and binds to DRE/CRT cis-acting elements in the promoters of stress-responsive genes. The significance of DREB1B in plant research lies in its potential application for developing stress-tolerant crops and understanding stress signaling pathways. Studies of DREB1B are particularly valuable for elucidating molecular mechanisms of stress adaptation in plants .

What are the key specifications of anti-DREB1B antibodies used in research?

The anti-DREB1B antibody commonly used in research is a rabbit polyclonal antibody generated against a synthetic peptide corresponding to amino acids 50-150 of Arabidopsis thaliana DREB1B (NP_567721.1). The antibody reacts specifically with Arabidopsis thaliana samples and is validated for Western blot applications. The recommended dilution range for Western blot experiments is 1:500-1:1,000. The antibody recognizes the sequence GVRQRNSGKWVSEVREPNKKTRIWLGTFQTAEMAARAHDVAALALRGRSACLNFADSAWRLRIPESTCAKDIQKAAAEAALAFQDETCDTTTTNHGLDMEE within the DREB1B protein .

How does DREB1B function differ from other DREB family proteins?

DREB1B is part of the DREB1/CBF subfamily, which includes multiple members (DREB1A/CBF3, DREB1B/CBF1, DREB1C/CBF2, etc.) that have partially overlapping but distinct functions. DREB1B specifically responds to cold stress and is rapidly induced upon exposure to low temperatures. While all DREB1 proteins bind to the DRE/CRT element (core sequence: A/GCCGAC), they differ in their expression patterns, timing of induction, and downstream gene activation profiles. DREB1B shows stronger induction under cold conditions compared to drought or salt stress, whereas other family members like DREB2 proteins are more responsive to dehydration and salt stress .

What are the optimal conditions for using anti-DREB1B antibody in Western blot experiments?

For optimal Western blot results with anti-DREB1B antibody, researchers should follow these methodological guidelines:

• Sample preparation: Extract proteins from Arabidopsis tissues using standard extraction buffers containing protease inhibitors.

• Protein loading: Load 25μg of protein per lane for clear detection.

• Antibody dilution: Use the anti-DREB1B antibody at 1:500-1:1,000 dilution.

• Secondary antibody: Use Goat Anti-Rabbit IgG H&L Antibody conjugated with HRP at 1:10,000 dilution.

• Blocking solution: Block with 3% non-fat dry milk in TBST.

• Detection system: Use ECL-based chemiluminescence detection.

• Exposure time: Start with 30 seconds, adjusting as needed based on signal strength.

These conditions have been validated for detection of DREB1B in Arabidopsis thaliana tissue extracts .

What stress treatments are recommended for inducing DREB1B expression in experimental systems?

To effectively induce DREB1B expression for experimental analysis, the following stress treatments are recommended:

• Cold stress: Expose plants to 4°C for periods ranging from 1 hour to 24 hours, with peak DREB1B expression typically occurring between 3-12 hours.

• Temperature range: For differential expression studies, a temperature series (22°C, 16°C, 10°C, 4°C, and 0°C) can reveal the threshold and gradient of DREB1B induction.

• Developmental stage: Cold treatments are most effective when applied to 2-3 week old seedlings grown under standard conditions.

• Treatment method: For consistent results, transfer entire plates of seedlings to cold chambers rather than applying ice or cold solutions.

• Control conditions: Maintain control plants at standard growth temperatures (20-22°C) with identical light and humidity conditions.

These protocols enable reliable induction of DREB1B for subsequent protein extraction and immunoblotting experiments .

How can researchers optimize protein extraction protocols for DREB1B detection?

For optimal DREB1B protein extraction from plant tissues, researchers should implement this methodological approach:

• Tissue selection: Harvest young leaves or whole seedlings, as DREB1B expression is typically higher in younger tissues.

• Timing: Collect tissue samples at peak expression times after stress treatment (typically 6-12 hours after cold exposure).

• Sample preservation: Flash-freeze harvested tissues in liquid nitrogen and store at -80°C until processing.

• Extraction buffer: Use a protein extraction buffer containing 50 mM Tris-HCl (pH 7.5), 150 mM NaCl, 1 mM EDTA, 0.1% Triton X-100, 10% glycerol, and freshly added protease inhibitors.

• Nuclear protein enrichment: Since DREB1B is a transcription factor, nuclear protein extraction protocols may improve detection sensitivity.

• Homogenization: Thoroughly grind tissue in liquid nitrogen before adding extraction buffer (ratio of 1:3 w/v).

• Centrifugation steps: First centrifuge at 14,000 rpm for 15 minutes at 4°C, then collect supernatant for protein quantification.

This optimized extraction protocol ensures sufficient yield and quality of DREB1B protein for subsequent immunoblotting analyses .

What are common issues with DREB1B antibody specificity and how can they be addressed?

Researchers may encounter several specificity issues when working with DREB1B antibodies. Here are methodological approaches to address them:

• Cross-reactivity with related DREB proteins: The DREB family contains highly similar proteins (DREB1A, DREB1C, etc.) that may cross-react with DREB1B antibodies. To address this:

  • Perform validation using dreb1b knockout mutants as negative controls

  • Include recombinant DREB1B protein as a positive control

  • Pre-adsorb antibody with recombinant related proteins to improve specificity

• Background bands: Non-specific binding may result in background bands. Optimize by:

  • Increasing blocking concentration to 5% BSA or milk

  • Performing more stringent washing steps (5 × 10 minutes in TBST)

  • Testing a range of antibody dilutions (1:250 to 1:2,000)

• Weak signal: If DREB1B signal is weak despite proper induction:

  • Enrich for nuclear proteins using nuclear extraction protocols

  • Reduce washing stringency slightly

  • Increase protein loading to 40-50 μg per lane

  • Extend primary antibody incubation to overnight at 4°C

• Validation approaches: Confirm specificity through:

  • Peptide competition assays using the immunizing peptide

  • Parallel analysis with another DREB1B antibody raised against a different epitope

  • Correlation with DREB1B mRNA expression patterns

How can researchers distinguish between DREB1B phosphorylated states in stress response studies?

Detecting and distinguishing phosphorylated states of DREB1B requires specialized approaches:

• Phosphorylation detection methods:

  • Phos-tag SDS-PAGE: Incorporate Phos-tag acrylamide (50-100 μM) and MnCl₂ (100-200 μM) in standard SDS-PAGE to separate phosphorylated DREB1B forms, appearing as mobility-shifted bands

  • Phospho-specific antibodies: When available, use antibodies specifically recognizing known DREB1B phosphorylation sites

  • Lambda phosphatase treatment: Treat duplicate samples with λ-phosphatase to confirm bands represent phosphorylated forms

• Sample preparation considerations:

  • Include phosphatase inhibitors (10 mM NaF, 1 mM Na₃VO₄, 10 mM β-glycerophosphate) in all extraction buffers

  • Maintain samples at 4°C throughout processing to preserve phosphorylation status

  • Use freshly prepared samples, as freeze-thaw cycles can affect phosphorylation detection

• Experimental design for phosphorylation studies:

  • Time-course analysis after stress application (0, 5, 15, 30 min, 1, 3, 6, 24 h)

  • Combine with protein kinase inhibitors to identify responsible kinases

  • Compare phosphorylation patterns across different stress types (cold, drought, salt)

• Data interpretation:

  • Quantify the ratio of phosphorylated to non-phosphorylated forms

  • Correlate phosphorylation status with transcriptional activity using parallel ChIP assays

  • Compare wild-type phosphorylation patterns with those in kinase mutants

What controls should be included when validating DREB1B antibody specificity?

A comprehensive validation of DREB1B antibody specificity requires multiple controls:

• Essential negative controls:

  • dreb1b knockout/knockdown mutant plant extracts

  • Pre-immune serum at the same dilution as the antibody

  • Secondary antibody-only control

  • Peptide competition assay using the immunizing peptide

• Positive controls:

  • Plants overexpressing DREB1B (preferably with a small tag that doesn't interfere with antibody binding)

  • Cold-stressed wild-type plants (known to induce DREB1B)

  • Recombinant DREB1B protein (if available)

• Specificity controls:

  • Extracts from plants overexpressing related DREB proteins (DREB1A, DREB1C) to assess cross-reactivity

  • Analysis of multiple Arabidopsis accessions to confirm consistent detection

  • Comparison of signal in different tissues with known DREB1B expression profiles

• Technical validation:

  • Molecular weight verification (expected size: approximately 24-27 kDa)

  • Parallel detection with RT-qPCR of DREB1B transcript

  • Comparison with a second anti-DREB1B antibody recognizing a different epitope

These systematically implemented controls ensure reliable antibody specificity and experimental validity .

How can DREB1B antibodies be used in chromatin immunoprecipitation (ChIP) experiments?

DREB1B antibodies can be adapted for ChIP experiments to identify in vivo binding sites following this methodological approach:

• Chromatin preparation:

  • Cross-link proteins to DNA using 1% formaldehyde for 10 minutes

  • Quench with 0.125 M glycine

  • Extract nuclei using sucrose-based buffers

  • Sonicate chromatin to fragments of 200-500 bp

• Immunoprecipitation protocol:

  • Pre-clear chromatin with protein A/G beads

  • Incubate chromatin with anti-DREB1B antibody (5-10 μg) overnight at 4°C

  • Use 2-5 times more antibody than for Western blot applications

  • Include negative control with pre-immune serum or IgG

  • Include input sample (5-10% of starting chromatin)

• Washing and elution:

  • Perform stringent washing with increasing salt concentrations

  • Elute DNA-protein complexes with SDS-containing buffer

  • Reverse cross-links by heating at 65°C overnight

  • Treat with proteinase K and RNase A

  • Purify DNA using phenol-chloroform extraction or column purification

• Analysis of ChIP-DNA:

  • Perform qPCR targeting known DREB1B-regulated genes containing DRE elements

  • Analyze genome-wide binding through ChIP-seq

  • Calculate enrichment as percent of input or relative to control regions

• Expected targets:

  • DREB1B binds to the consensus sequence A/GCCGAC (DRE/CRT elements)

  • Look for enrichment in promoters of cold-responsive genes like COR15A, RD29A, and KIN1

What is the relationship between DREB1B expression patterns and stress tolerance phenotypes?

The relationship between DREB1B expression and stress tolerance demonstrates complex patterns that researchers should consider when interpreting experimental data:

• Expression-phenotype correlation:

  DREB1B Expression Level	Cold Tolerance	Drought Tolerance	Growth Phenotype
  Wild-type (stress-induced)	Moderate	Low-moderate	Normal
  Constitutive overexpression	High	Moderate-high	Stunted growth, delayed flowering
  Stress-inducible overexpression	High	Moderate	Minimal growth effects
  Knockout/knockdown	Reduced	Slightly reduced	Normal
  Phosphorylation-site mutants	Variable	Variable	Variable

• Tissue-specific expression effects:

  • Guard cell-specific expression improves drought tolerance without growth penalties

  • Root-specific expression enhances osmotic stress tolerance

  • Shoot apical meristem expression provides strongest freezing protection

• Temporal expression dynamics:

  • Early induction (0-3h after stress) correlates with acquired tolerance

  • Prolonged expression can trigger negative feedback mechanisms

  • Cyclic cold treatment induces stronger protection than continuous exposure

• Molecular indicators of DREB1B-mediated tolerance:

  • Increased proline and soluble sugar accumulation

  • Enhanced ROS scavenging enzyme activity

  • Membrane stability under stress conditions

  • Altered cell wall composition

• Experimental approaches to assess correlation:

  • Compare multiple independent transgenic lines with varying DREB1B expression levels

  • Perform time-course analyses correlating protein levels with physiological parameters

  • Use inducible expression systems to separate developmental from stress-responsive effects

How do various plant species differ in DREB1B structure and antibody cross-reactivity?

Cross-species reactivity of DREB1B antibodies varies based on protein conservation across plant species:

• Evolutionary conservation of DREB1B:

  Plant Group	DREB1B Homology to Arabidopsis	Antibody Cross-Reactivity	Key Structural Differences
  Brassicaceae (e.g., Brassica)	75-90%	Strong	Minor variations in C-terminal region
  Other dicots (e.g., tomato, soybean)	50-70%	Moderate, variable	Divergent C-terminus, conserved AP2 domain
  Monocots (e.g., rice, wheat)	40-60%	Weak to none	Distinct C-terminus, conserved DNA-binding domain
  Gymnosperms	35-45%	Minimal	Highly divergent structure outside AP2 domain

• Domain-specific conservation:

  • AP2/ERF DNA-binding domain: Highly conserved (>80% across angiosperms)

  • N-terminal acidic domain: Moderately conserved in closely related species

  • C-terminal region: Most variable, species-specific modifications

• Methodological approaches for cross-species applications:

  • Test antibody dilutions from 1:100 to 1:1,000 for distant species

  • Adjust extraction buffers to species-specific optimal conditions

  • Validate with recombinant proteins or overexpression systems when possible

  • Consider raising antibodies against conserved peptide sequences for multi-species studies

• Experimental design considerations:

  • For non-model species, sequence the DREB1B homolog to assess epitope conservation

  • Use multiple antibodies targeting different regions for confirmation

  • Include appropriate positive controls from Arabidopsis

  • Consider using tagged versions of the protein in heterologous systems

How can DREB1B antibodies be used to study protein-protein interactions in stress response pathways?

Advanced methodologies using DREB1B antibodies can reveal critical protein-protein interactions:

• Co-immunoprecipitation (Co-IP) approaches:

  • Standard Co-IP: Extract proteins under non-denaturing conditions, immunoprecipitate with anti-DREB1B antibody, and identify interacting partners by Western blot or mass spectrometry

  • Reverse Co-IP: Immunoprecipitate with antibodies against suspected interacting partners and probe for DREB1B

  • Crosslinking-assisted Co-IP: Use membrane-permeable crosslinkers like DSP or formaldehyde to capture transient interactions

• Recommended buffer conditions for preserving interactions:

  • Extraction buffer: 50 mM Tris-HCl (pH 7.5), 150 mM NaCl, 0.5% NP-40, 10% glycerol, 1 mM EDTA, protease inhibitors

  • Wash buffers: Use decreasing detergent concentrations (0.1-0.5% NP-40) to balance specificity and interaction preservation

  • Avoid harsh detergents like SDS that disrupt protein-protein interactions

• Known and predicted DREB1B interaction partners:

  • Components of the basal transcription machinery

  • Chromatin remodeling complexes

  • Other transcription factors (bZIPs, MYBs)

  • Protein kinases involved in stress signaling

  • Ubiquitin ligases regulating DREB1B stability

• Advanced techniques for interaction studies:

  • Proximity ligation assay (PLA) for in situ detection of protein interactions

  • Bimolecular fluorescence complementation (BiFC) with epitope-tagged DREB1B

  • FRET/FLIM analysis using antibody-based fluorescent labeling

What methodological approaches combine transcriptomics with DREB1B protein analysis?

Integrated approaches linking DREB1B protein levels with transcriptomic responses provide deeper mechanistic insights:

• Combined ChIP-seq and RNA-seq experimental design:

  • Perform ChIP-seq with anti-DREB1B antibody to identify genome-wide binding sites

  • Conduct parallel RNA-seq on the same samples to correlate binding with expression changes

  • Compare wild-type with dreb1b mutants under control and stress conditions

  • Include time-course analysis (0, 1, 3, 6, 24h after stress) to capture primary and secondary targets

• Data integration approach:

  • Identify direct DREB1B targets (genes with both binding sites and expression changes)

  • Analyze promoter elements of direct targets to refine DREB1B binding motifs

  • Construct gene regulatory networks using direct and indirect targets

  • Validate key nodes through reverse genetics approaches

• Protein-level correlation analysis:

  • Quantify DREB1B protein levels by Western blot across the time course

  • Correlate protein abundance with temporal patterns of target gene expression

  • Analyze DREB1B phosphorylation status in relation to target gene activation

  • Investigate the relationship between DREB1B degradation and target gene expression decline

• Advanced statistical approaches:

  • Time-lagged correlation analysis between protein levels and transcript changes

  • Machine learning to identify patterns in multi-omics datasets

  • Network analysis to identify DREB1B-centered regulatory modules

How can researchers study post-translational modifications of DREB1B using available antibodies?

Studying post-translational modifications (PTMs) of DREB1B requires specialized approaches:

• Detection of phosphorylation:

  • Phos-tag gel electrophoresis combined with anti-DREB1B antibody detection

  • Immunoprecipitation followed by phospho-specific protein staining (ProQ Diamond)

  • Mass spectrometry analysis after immunoprecipitation with anti-DREB1B antibody

  • Treatment with various kinase inhibitors to identify regulatory pathways

• Analysis of ubiquitination and protein stability:

  • Immunoprecipitate DREB1B and probe with anti-ubiquitin antibodies

  • Treat plants with proteasome inhibitors (MG132) to observe DREB1B accumulation

  • Cycloheximide chase assays to measure protein half-life under different conditions

  • Compare degradation patterns in various E3 ligase mutant backgrounds

• Sumoylation and other modifications:

  • Immunoprecipitate with anti-DREB1B and probe with anti-SUMO antibodies

  • Use desumoylation inhibitors to enhance detection

  • Analyze size shifts in Western blots under various stress conditions

  • Compare modification patterns between wild-type and PTM pathway mutants

• Experimental design considerations:

  • Include appropriate controls for each modification (e.g., phosphatase treatment)

  • Perform time-course experiments to capture dynamic modification patterns

  • Compare modifications across different stresses (cold, drought, salt)

  • Correlate modifications with DNA-binding capacity using gel shift assays

• Functional analysis of modifications:

  • Generate phospho-mimetic and phospho-null DREB1B variants

  • Complement dreb1b mutants with modified versions

  • Assess stress tolerance phenotypes

  • Measure transcriptional activation capacity of modified DREB1B proteins