DUS3 Antibody

Shipped with Ice Packs
In Stock

Description

DUS3L Antibody

DUS3L (UniProt ID: Q96G46) is a tRNA-dihydrouridine synthase involved in post-transcriptional RNA modification. Antibodies against DUS3L are primarily used to study its role in tRNA stability and cellular stress responses.

Key Antibody Characteristics:

AntibodySupplierHostClonalityApplicationsTarget Region
Anti-DUS3L (HPA062846)Sigma-AldrichRabbitPolyclonalIF (0.25–2 µg/mL)DIRGKLYLAPLTTCGNLPFRRICKRFGADVTCGEMAVCTNLLQGQMSEWALLKRHQCEDIFGVQLEGAFPDTMTKCAELL
DUS3L (A304-641A)Thermo FisherRabbitPolyclonalWB, IPFull-length human DUS3L
  • Research Findings:

    • DUS3L antibodies have been validated in immunofluorescence and Western blotting (WB) applications, with specificity confirmed using knockout (KO) cell lines .

    • DUS3L is implicated in metabolic regulation, particularly in insulin signaling and non-alcoholic fatty liver disease (NAFLD) via interactions with tRNA modifications .

DUSP3/VHR Antibody

DUSP3 (Dual Specificity Phosphatase 3), also known as VHR, is a phosphatase regulating mitogen-activated protein kinase (MAPK) signaling. Antibodies against DUSP3 are critical for oncology and immunology research.

Key Antibody Characteristics:

AntibodySupplierHostClonalityApplicationsSpecific Features
DUSP3/VHR (#4752)Cell SignalingRabbitMonoclonalWB (1:1000), IP (1:50)Detects endogenous DUSP3; no cross-reactivity with other phosphatases
Anti-DUSP3 (E02/5H5)Bio-RadMouseMonoclonalWB (1:2000), IPTargets aa 1–185 of human DUSP3
Anti-DUSP3 (ab125077)AbcamRabbitMonoclonalWB, IHC-PRecombinant monoclonal; recognizes ERK/JNK phosphatase activity
  • Research Findings:

    • DUSP3 antibodies are used to study cancer progression, with elevated DUSP3 levels linked to cervical and prostate cancers .

    • In metabolic studies, DUSP3 knockdown increases insulin receptor phosphorylation, suggesting a role in insulin resistance .

Antibody Validation and Challenges

Recent studies highlight the importance of rigorous antibody validation:

  • YCharOS Initiative: Evaluated 614 antibodies, finding ~12% of published studies used non-specific antibodies. Recombinant antibodies (e.g., ab125077) outperformed polyclonal ones in specificity .

  • Controls: KO cell lines are recommended for WB/IF validation to minimize off-target effects .

Clinical and Therapeutic Relevance

While DUS3/DUSP3 antibodies are primarily research tools, their targets have therapeutic potential:

  • DUSP3: Modulates MAPK pathways, a hotspot for oncology drug development .

  • DUS3L: Linked to tRNA dysregulation in metabolic disorders, suggesting diagnostic utility .

Future Directions

  • Biomarker Development: DUSP3’s role in ERK/JNK signaling warrants exploration as a cancer biomarker .

  • High-Throughput Screening: Antibodies like #4752 could enable drug discovery for phosphatase inhibitors .

Product Specs

Buffer
Preservative: 0.03% Proclin 300
Constituents: 50% Glycerol, 0.01M PBS, pH 7.4
Form
Liquid
Lead Time
Made-to-order (14-16 weeks)
Synonyms
DUS3 antibody; SCY_3953tRNA-dihydrouridine(47) synthase [NAD(P)(+)] antibody; EC 1.3.1.89 antibody; tRNA-dihydrouridine synthase 3 antibody
Target Names
DUS3
Uniprot No.

Target Background

Function
This antibody targets DUS3, an enzyme that catalyzes the synthesis of dihydrouridine. Dihydrouridine is a modified base found in the D-loop of most tRNAs. DUS3 specifically modifies U47 in cytoplasmic tRNAs.
Protein Families
Dus family, Dus3 subfamily
Subcellular Location
Cytoplasm. Nucleus.

Q&A

What is DUSP3 protein and why is it important in research?

DUSP3, also known as vaccinia H1-related phosphatase (VHR), is a member of the dual-specificity phosphatase family that dephosphorylates both threonine/serine and tyrosine residues of substrate proteins. DUSP3 targets several important signaling molecules including MAPKs ERK and JNK, STAT5, and ErbB2, making it a critical regulator of multiple cellular pathways . Its significance in research stems from its involvement in cancer development (including cervical and prostate cancers), insulin signaling, and tight junction regulation . DUSP3's role as a phosphatase that modulates key signaling cascades positions it as an important research target for understanding cellular regulatory mechanisms and potential therapeutic interventions in several pathological conditions.

How do I select the appropriate DUSP3 antibody clone for my research?

Selecting the appropriate DUSP3 antibody requires consideration of multiple experimental factors:

  • Application compatibility: Verify the antibody has been validated for your specific application (Western blot, immunohistochemistry, etc.). For example, the E02/5H5 clone has been validated for Western blotting at 1/2000 dilution and immunoprecipitation at 2.5 μg .

  • Species reactivity: Ensure the antibody recognizes DUSP3 in your experimental species. Some antibodies like the PACO08950 polyclonal antibody show reactivity with human, mouse, and rat samples .

  • Epitope location: Consider whether the antibody's epitope might be masked in your experimental conditions. The E02/5H5 clone recognizes an epitope within amino acids 1-185 of human DUSP3 .

  • Clone performance: Review published literature using the specific clone to assess its performance in similar experimental settings.

  • Antibody format: Determine whether a monoclonal (like E02/5H5) or polyclonal antibody best suits your research needs based on specificity requirements and application context .

What are the distinct characteristics of DUSP3 versus DUS3L antibodies?

Despite their similar nomenclature, DUSP3 and DUS3L represent different proteins with distinct functions and require different antibodies:

CharacteristicDUSP3 AntibodyDUS3L Antibody
Target proteinDual-specificity phosphatase 3 (VHR)Dihydrouridine synthase 3-like exoribonuclease
Protein functionDephosphorylates threonine/serine and tyrosine residues on substrates like MAPKs Catalyzes synthesis of dihydrouridine in tRNAs; involved in RNA stability and degradation
Molecular weightDetects a band of approximately 20 kDa Varies by isoform (3 known isoforms)
Cellular localizationPrimarily cytoplasmicCytoplasmic
Disease associationsCancer progression, insulin resistance, NAFLD RNA metabolism disorders

Researchers must be careful not to confuse these distinct proteins when designing experiments and interpreting results, as they function in different cellular pathways despite their similar naming conventions .

What are the validated applications for DUSP3 antibodies and their optimal protocols?

DUSP3 antibodies have been validated for several research applications, each with specific recommended protocols:

Western Blotting:

  • Recommended dilution: 1/2000 for E02/5H5 clone

  • Expected band size: 20 kDa in human samples

  • Positive control: U-87 MG cell lysates have been verified

  • Protocol notes: Standard reducing conditions; protein concentration should be optimized

Immunoprecipitation:

  • Recommended amount: 2.5 μg of antibody per IP reaction

  • Protocol notes: Protein A/G beads recommended; pre-clearing lysates can reduce background

Immunohistochemistry:

  • Validated with PACO08950 antibody for human tissues

  • Protocol notes: May require antigen retrieval; optimal dilution should be determined empirically

Proximity Ligation Assay (PLA):

  • Successfully used to detect DUSP3 proximity to tight junction proteins

  • Protocol notes: Controls with single primary antibody are essential to validate specificity

Each application requires careful optimization for specific experimental conditions, with particular attention to sample preparation and antibody concentration .

How can I troubleshoot weak or absent DUSP3 signal in Western blot applications?

When encountering weak or absent DUSP3 signals in Western blots, consider this systematic troubleshooting approach:

  • Sample preparation issues:

    • Ensure complete protein extraction using phosphatase inhibitors to prevent DUSP3 degradation

    • Verify protein concentration and loading consistency

    • DUSP3 levels can vary significantly between cell types and conditions

  • Antibody-related factors:

    • Confirm antibody integrity (avoid repeated freeze-thaw cycles that may denature antibodies)

    • Try increased antibody concentration (start with 2-3× recommended dilution)

    • Extend primary antibody incubation (overnight at 4°C may improve signal)

  • Detection challenges:

    • Given DUSP3's relatively low molecular weight (20 kDa), ensure your gel resolution is appropriate

    • Use higher percentage gels (15-18%) for better resolution of low-MW proteins

    • Consider enhancing detection with more sensitive substrates (e.g., enhanced chemiluminescence)

  • Technical validation:

    • Run a positive control sample (U-87 MG cell lysate has been validated)

    • If possible, include DUSP3-overexpressing and DUSP3-knockout samples as controls

    • Verify transfer efficiency for small proteins using reversible staining

  • Expression considerations:

    • DUSP3 expression varies by cell/tissue type and can be altered in disease states

    • Consider using cellular fractionation as DUSP3 distribution may vary between compartments

What methodologies can effectively assess DUSP3 phosphatase activity in research samples?

Assessing DUSP3 phosphatase activity requires specialized approaches beyond simple detection of protein levels:

  • In vitro phosphatase assays:

    • Immunoprecipitate DUSP3 using validated antibodies (e.g., E02/5H5 clone at 2.5 μg)

    • Use artificial substrates like p-nitrophenyl phosphate (pNPP) to measure general phosphatase activity

    • For substrate-specific activity, use phosphorylated peptides derived from known DUSP3 targets (ERK, JNK)

    • Quantify dephosphorylation using colorimetric or fluorometric readouts

  • Cellular phosphorylation status:

    • Monitor phosphorylation levels of known DUSP3 substrates (ERK, JNK, STAT5)

    • Compare phospho-protein levels in DUSP3-depleted versus wild-type cells

    • Use phospho-specific antibodies in Western blot or ELISA formats

  • Proximity-based approaches:

    • Proximity ligation assays (PLA) can detect DUSP3's association with substrates in situ

    • This method successfully demonstrated DUSP3's proximity to tight junction proteins

    • PLA signals were significantly higher in DUSP3-expressing cells compared to DUSP3-knockout cells (p<0.01)

  • Genetic manipulation validation:

    • Compare phosphatase activity in systems with wild-type DUSP3 versus phosphatase-dead mutant (DUSP3-CS)

    • The phosphatase-dead mutant has been shown to decrease interaction between OCLN and ZO-1

How does DUSP3 depletion affect tight junction integrity and epithelial barrier function?

DUSP3 depletion significantly compromises tight junction integrity and epithelial barrier function through several mechanisms:

  • Altered tight junction protein expression:

    • DUSP3-deficient cells (DUSP3+/− and DUSP3−/−) show significantly decreased ZO-1 protein levels

    • ZO-1 fails to display typical tight junction distribution patterns in DUSP3−/− cells

    • Other junction proteins like occludin (OCLN) and cadherins maintain normal expression levels

  • Compromised barrier function:

    • DUSP3-deficient cells exhibit significantly higher permeability to FITC-dextran particles

    • Trans-epithelial electrical resistance (TEER) measurements show lower values in DUSP3+/− and DUSP3−/− cells compared to DUSP3+/+ controls

    • These functional defects occur independent of cell cycle arrest or apoptosis

  • Molecular interaction disruption:

    • DUSP3 normally enhances the interaction between OCLN and ZO-1

    • Expression of phosphatase-dead DUSP3 (DUSP3-CS) decreases this interaction

    • DUSP3 also promotes interaction between ZO-1 and cytoskeletal β-actin, stabilizing junction complexes

  • In vivo confirmation:

    • ZO-1 levels are significantly lower in lung tissues of DUSP3−/− mice (p<0.05)

    • In EGFR-mutant lung adenocarcinoma models, DUSP3 deficiency exacerbates tight junction defects

These findings establish DUSP3 as an important regulator of epithelial integrity, with implications for understanding epithelial cancer progression and other barrier dysfunction disorders .

What is the role of DUSP3 in insulin signaling and metabolic disorders?

DUSP3 functions as an important regulator in insulin signaling pathways with significant implications for metabolic disorders:

  • Insulin receptor regulation:

    • DUSP3 dephosphorylates the insulin receptor (IR), modulating its activity

    • Decreased DUSP3 levels lead to increased IR phosphorylation and heightened downstream signaling pathway activation

  • Metabolic disorder implications:

    • DUSP3 deficiency contributes to several metabolic conditions:

      • Obesity progression

      • Insulin resistance development

      • Non-alcoholic fatty liver disease (NAFLD)

      • Liver damage

  • Molecular mechanism:

    • As a dual-specificity phosphatase, DUSP3 can dephosphorylate both threonine/serine and tyrosine residues

    • This capability allows precise regulation of insulin signaling cascades that involve multiple phosphorylation types

    • The dysregulation of this balance in DUSP3 deficiency contributes to pathological metabolic states

  • Research applications:

    • DUSP3 antibodies enable monitoring of this protein's expression levels in metabolic disease models

    • Correlation studies between DUSP3 levels and insulin receptor phosphorylation status provide insights into disease mechanisms

    • DUSP3 may represent a potential therapeutic target for metabolic disorders

This relationship between DUSP3 and metabolic regulation highlights the importance of studying this phosphatase in the context of prevalent conditions like obesity and diabetes .

How is DUSP3 involved in cancer progression and what are the implications for research?

DUSP3 exhibits complex roles in cancer progression that vary by cancer type, with significant research implications:

  • Cancer type-specific involvement:

    • Cervical cancer: DUSP3 expression alterations contribute to disease development

    • Prostate cancer: DUSP3 plays a documented role in cancer progression

    • Lung adenocarcinoma: DUSP3 deficiency accelerates EGFR-mutant tumor progression

  • Mechanistic contributions to cancer progression:

    • Tight junction disruption: DUSP3−/− mice show exacerbated tight junction defects in lung adenocarcinoma

    • ZO-1 dysregulation: Tumors in EGFR-Del Tg/DUSP3−/− mice display lower ZO-1 staining compared to adjacent normal tissues

    • Chromosomal instability: DUSP3-deficient cells show DNA hyperploidy or hypoploidy, suggesting a role in maintaining chromosomal stability

  • Signaling pathway modulation:

    • DUSP3 regulates key oncogenic pathways through dephosphorylation of:

      • MAPKs (ERK and JNK) involved in proliferation and survival

      • STAT5 implicated in cancer cell growth

      • ErbB2, an important oncogenic receptor

  • Research applications:

    • DUSP3 antibodies enable monitoring of expression changes during cancer progression

    • Comparison of DUSP3 levels between tumor and normal tissues provides diagnostic insights

    • DUSP3 status assessment may help predict cancer aggressiveness and treatment response

  • Therapeutic implications:

    • Understanding DUSP3's role suggests potential for targeted therapeutic approaches

    • Restoring DUSP3 function might help maintain epithelial integrity and slow progression

    • DUSP3 status could potentially serve as a biomarker for treatment stratification

These findings establish DUSP3 as an important research target for understanding cancer progression mechanisms, particularly in epithelial malignancies .

What experimental controls are essential when using DUSP3 antibodies in complex signaling pathway studies?

When using DUSP3 antibodies to investigate complex signaling pathways, implementing rigorous controls is crucial for valid interpretation:

  • Antibody validation controls:

    • Positive control samples: Use validated cell lines known to express DUSP3 (e.g., U-87 MG cells)

    • Genetic controls: Include DUSP3-knockout or knockdown samples to confirm antibody specificity

    • Overexpression controls: Compare with samples expressing tagged DUSP3 that can be detected by alternative methods

    • Peptide competition: Pre-incubate antibody with immunizing peptide (e.g., E. coli-derived recombinant protein, aa 1-185 of human DUSP3)

  • Pathway-specific controls:

    • Phosphatase inhibitor treatment: Compare samples with and without inhibitors to distinguish DUSP3-specific effects

    • Phosphatase-dead mutant: Include DUSP3-CS mutant samples to distinguish catalytic vs. scaffolding functions

    • Pathway activators/inhibitors: Use treatments that activate or inhibit DUSP3 substrates (ERK, JNK, STAT5)

    • Time-course experiments: Establish temporal relationships between DUSP3 activity and substrate phosphorylation

  • Proximity and interaction controls:

    • Single antibody controls: In proximity ligation assays, include single-antibody controls to establish background levels

    • Pull-down specificity: In co-IP experiments, include IgG controls and reverse immunoprecipitation

    • Subcellular fractionation: Verify DUSP3 localization relative to potential substrates and interactors

  • Functional validation approaches:

    • Rescue experiments: Reintroduce wild-type DUSP3 into depleted systems to confirm phenotype reversal

    • Substrate mutant analysis: Use non-phosphorylatable mutants of putative substrates to confirm specificity

These comprehensive controls ensure that observations attributed to DUSP3 are specific and not artifacts of experimental design or antibody cross-reactivity .

How can DUSP3 antibodies be utilized to investigate the cross-talk between tight junction regulation and cancer signaling pathways?

DUSP3 antibodies can serve as powerful tools to explore the intersection between tight junction dysregulation and cancer signaling:

  • Co-localization studies:

    • Perform multi-color immunofluorescence using DUSP3 antibodies alongside tight junction markers (ZO-1, OCLN) and signaling pathway components

    • Analyze spatial relationships in normal versus cancerous tissues

    • Changes in co-localization patterns can reveal mechanisms of cancer-associated junction disruption

  • Protein complex analysis:

    • Use DUSP3 antibodies for co-immunoprecipitation to identify dynamic protein complexes

    • Compare complex composition between normal and cancer cells

    • Proximity ligation assays (PLA) can detect DUSP3's association with junctional proteins in situ, as demonstrated with significantly higher PLA signals (p<0.01) in DUSP3-expressing versus DUSP3-knockout cells

  • Phosphorylation state monitoring:

    • Combine DUSP3 antibodies with phospho-specific antibodies to track:

      • Changes in tight junction protein phosphorylation states

      • Correlation between DUSP3 levels and phosphorylation of cancer signaling molecules

    • Immunoblotting can reveal how DUSP3 depletion affects phosphorylation status of multiple pathway components

  • Temporal dynamics investigation:

    • Use DUSP3 antibodies in time-course experiments following cancer-relevant stimuli

    • Track changes in DUSP3-associated complexes during epithelial-to-mesenchymal transition

    • Monitor tight junction protein distribution in relation to DUSP3 expression during cancer progression

  • Therapeutic intervention assessment:

    • Evaluate how potential cancer therapeutics affect DUSP3 expression and activity

    • Determine whether restoring DUSP3 function can reverse junction disruption in cancer models

    • Track tight junction integrity using ZO-1 distribution patterns in DUSP3-manipulated systems

This multifaceted approach using DUSP3 antibodies can reveal mechanistic insights into how tight junction dysregulation contributes to cancer progression and identify potential intervention points .

What are the methodological considerations for using DUSP3 antibodies in engineered mouse models of human disease?

Using DUSP3 antibodies in engineered mouse models requires specific methodological considerations to ensure valid translational results:

These considerations ensure that DUSP3 antibody-based studies in mouse models provide reliable insights into human disease mechanisms and potential therapeutic approaches .

How might emerging proteomic approaches enhance DUSP3 antibody-based research?

Emerging proteomic technologies offer significant opportunities to advance DUSP3 antibody-based research:

  • Mass spectrometry-coupled immunoprecipitation:

    • Use DUSP3 antibodies to immunoprecipitate native complexes followed by MS analysis

    • This approach can identify novel DUSP3-interacting proteins beyond known partners like OCLN and ZO-1

    • Quantitative proteomics can compare DUSP3 interaction networks in normal versus disease states

    • Cross-linking mass spectrometry (XL-MS) can capture transient DUSP3 interactions with substrates

  • Proximity-dependent labeling techniques:

    • Engineer DUSP3 fusion proteins with BioID or APEX2 for proximity labeling

    • Validate interactions using conventional DUSP3 antibodies

    • This approach can reveal the spatial organization of DUSP3 within signaling complexes

    • Temporal control of labeling can track dynamic changes in DUSP3 interaction networks

  • Single-cell proteomics applications:

    • Use DUSP3 antibodies in CyTOF or imaging mass cytometry

    • These techniques can reveal cell-to-cell heterogeneity in DUSP3 expression and activity

    • Correlation between DUSP3 levels and multiple signaling markers at single-cell resolution

    • Particularly relevant for cancer research where cellular heterogeneity is significant

  • Phosphoproteomics integration:

    • Combine DUSP3 antibody-based enrichment with phosphoproteomics

    • Compare phosphorylation landscapes between DUSP3-sufficient and DUSP3-deficient samples

    • This approach can identify both direct and indirect DUSP3 substrates

    • Network analysis can position DUSP3 within broader signaling cascades

  • Structural proteomics approaches:

    • Use antibodies to stabilize DUSP3 complexes for structural studies

    • Cryo-EM of DUSP3-substrate complexes could reveal molecular mechanisms of specificity

    • Hydrogen-deuterium exchange mass spectrometry with and without antibody binding can reveal conformational dynamics

These emerging approaches can significantly expand our understanding of DUSP3's diverse roles in cellular signaling, tight junction regulation, and disease progression .

What are the key research questions that remain unresolved in the field of DUSP3 biology?

Despite significant progress, several critical questions about DUSP3 biology remain unresolved:

  • Substrate specificity mechanisms:

    • How does DUSP3 achieve specificity for diverse substrates (ERK, JNK, STAT5, ErbB2)?

    • What structural features or cofactors direct DUSP3 to different substrates in different contexts?

    • Are there undiscovered DUSP3 substrates that explain its diverse biological effects?

  • Regulatory mechanisms:

    • How is DUSP3 itself regulated at transcriptional, post-transcriptional, and post-translational levels?

    • What triggers DUSP3 degradation, and how does this contribute to disease progression?

    • Are there feedback mechanisms between DUSP3 activity and substrate expression?

  • Tissue-specific functions:

    • Why does DUSP3 deficiency affect certain tissues (like lung epithelium) more profoundly than others?

    • How do tissue microenvironments influence DUSP3 function?

    • Are there tissue-specific DUSP3 interacting partners?

  • Cancer context paradoxes:

    • How does DUSP3 function as both a tumor suppressor and promoter depending on cancer type?

    • What determines whether DUSP3 will inhibit or promote cancer progression in a given context?

    • How does DUSP3's role in tight junction maintenance intersect with its regulation of proliferative signaling?

  • Therapeutic targeting potential:

    • Can DUSP3 activity be selectively modulated for therapeutic benefit?

    • Would restoring DUSP3 function in DUSP3-deficient cancers slow progression?

    • How might DUSP3 modulation affect response to existing cancer therapeutics?

  • Metabolic regulation mechanisms:

    • What is the precise molecular mechanism by which DUSP3 regulates insulin receptor signaling?

    • How does DUSP3 integrate metabolic signals with other cellular processes?

    • Could DUSP3 modulation represent a novel approach to treating metabolic disorders?

Addressing these questions will require sophisticated experimental approaches using well-characterized DUSP3 antibodies combined with genetic, biochemical, and cellular techniques .

How can researchers address the technical challenges in studying phosphatase-substrate interactions using DUSP3 antibodies?

Studying phosphatase-substrate interactions presents unique technical challenges that researchers can address through specialized approaches:

  • Substrate-trapping mutant strategies:

    • Generate "substrate-trapping" DUSP3 mutants (e.g., C124S) that bind but don't dephosphorylate substrates

    • Use DUSP3 antibodies to immunoprecipitate these mutants and capture substrate complexes

    • Combine with mass spectrometry to identify novel substrates

    • Compare binding profiles between wild-type and trapping mutants to distinguish between binding partners and substrates

  • Temporal resolution approaches:

    • Employ rapid immunoprecipitation techniques to capture transient DUSP3-substrate interactions

    • Use DUSP3 antibodies in time-course experiments with synchronous pathway activation

    • Apply kinetic modeling to correlate DUSP3 activity with substrate phosphorylation dynamics

    • Utilize optogenetic tools to achieve temporal control of DUSP3 activity

  • Spatial interaction mapping:

    • The proximity ligation assay (PLA) has successfully demonstrated DUSP3's proximity to tight junction proteins

    • PLA signals were significantly higher (p<0.01) in DUSP3-expressing cells than in DUSP3−/− cells, validating this approach

    • Combine with super-resolution microscopy to map DUSP3-substrate interactions at nanoscale resolution

    • Use fluorescence resonance energy transfer (FRET) with antibody-based detection to monitor interactions in living cells

  • Dephosphorylation site identification:

    • Combine DUSP3 antibody-based enrichment with phospho-proteomic analysis

    • Compare phosphorylation profiles between wild-type and DUSP3-deficient samples

    • Employ targeted phospho-specific antibodies to track specific dephosphorylation events

    • Use in vitro dephosphorylation assays with purified components to confirm direct activity

  • Competitive binding analysis:

    • Use antibodies that recognize different DUSP3 epitopes to probe accessibility during substrate interactions

    • Perform competition assays with known DUSP3 interactors to map binding interfaces

    • Develop antibodies specifically targeting the DUSP3 active site to probe catalytic interactions

These specialized approaches can overcome the inherent challenges in studying the typically transient and dynamic interactions between DUSP3 and its substrates, advancing our understanding of DUSP3's diverse cellular functions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.