efhc2 Antibody

What is EFHC2 and why is it studied in research?

EFHC2 (EF-hand domain-containing family member C2) is a 749 amino acid protein containing three DM10 domains and an EF-hand domain. It is widely expressed in peripheral tissues and the central nervous system. The gene encoding EFHC2 maps to human chromosome Xp11.3 and has been implicated in multiple neurological conditions. Research interest in EFHC2 has grown due to its potential role in:

• Recognition of facial fear and harm avoidance

• Turner syndrome, which features deficits in social cognition

• Possible associations with Norrie disease, an X-linked disorder primarily affecting the eye

• Potential links to juvenile myoclonic epilepsy

• Emerging role as an autoantibody marker in COVID-19

EFHC2 shares 41.6% homology with EFHC1, and exists as two isoforms due to alternative splicing events .

What types of EFHC2 antibodies are available for research applications?

Current research platforms offer multiple antibody formats targeting EFHC2:

Most antibodies target specific epitopes, with some targeting the N-terminal region and others recognizing sequences such as KEKFHKSQHWGFCNNVMMLVSDEKPGIGGEPLLGQKIKPKCSIYPKGDGSDVPSWVAFDKQVLSFDAYLEEEVLDKSQTNYRIR .

What are the validated applications for EFHC2 antibodies and their recommended dilutions?

Based on current validation data, EFHC2 antibodies can be reliably used in the following applications with recommended dilutions:

For IHC applications, human cerebellum shows moderate cytoplasmic positivity in Purkinje cells when stained with anti-EFHC2 antibodies .

How should I validate an EFHC2 antibody for my specific experimental system?

A methodical validation approach should include:

• Positive control selection: Use tissues/cells known to express EFHC2

  • Mouse cerebral cortex tissue shows good expression

  • Human cerebellum (particularly Purkinje cells)

  • U87-MG and MCF-7 cell lines have been validated as positive controls

• Specificity validation:

  • Compare staining pattern with published literature

  • Use recombinant EFHC2 proteins as competitive inhibitors

  • Consider testing in both human and mouse samples due to 76% sequence identity

• Technical validation:

  • For IHC: Test different antigen retrieval methods (pH 6 HIER recommended)

  • For WB: Validate with recombinant protein (human EFHC2 PrEST antigen available)

  • Include isotype controls and secondary antibody-only controls

• Cross-reactivity assessment:

  • Test in EFHC2 knockout models if available

  • Evaluate potential cross-reactivity with EFHC1 (41.6% homology)

What is the optimal fixation and sample preparation method for EFHC2 detection?

For IHC/IF applications:

• Use 10% neutral buffered formalin fixation for 24-48 hours

• Paraffin embedding with standard protocols

• HIER (Heat-Induced Epitope Retrieval) with citrate buffer at pH 6.0 is specifically recommended for EFHC2 antibodies

• 4-5 μm section thickness provides optimal staining results

For Western blot applications:

• Standard RIPA buffer extraction with protease inhibitors

• Include calcium chelators (EDTA/EGTA) due to calcium-binding EF-hand domains

• Avoid freeze-thaw cycles that may degrade the protein

• Consider using 40% glycerol in PBS (pH 7.2) for antibody storage to maintain stability

How can I determine which EFHC2 isoform is being detected by an antibody?

EFHC2 exists as two isoforms produced by alternative splicing. To determine which isoform your antibody detects:

• Epitope mapping: Compare the antibody epitope (often provided in product documentation) against the sequences of both isoforms

• Molecular weight analysis:

  • Run recombinant proteins of both isoforms alongside your samples

  • Compare band patterns to determine which isoform is being detected

• Isoform-specific immunogen selection:

  • Some antibodies are raised against regions specific to one isoform

  • Check if the immunogen sequence (e.g., KEKFHKSQHWGFCNNVMMLVSDEKPGIGGEPLLGQKIKPKCSIYPKGDGSDVPSWVAFDKQVLSFDAYLEEEVLDKSQTNYRIR) is present in both isoforms

• RNA validation: Correlate protein detection with RT-PCR using isoform-specific primers to confirm expression patterns

How can EFHC2 antibodies be utilized to study neurodevelopmental disorders?

Given EFHC2's implications in neurological conditions, research methodologies could include:

• Comparative expression analysis:

  • Use IHC and WB to compare EFHC2 expression in neural tissues from patients with Turner syndrome, epilepsy, or neurodevelopmental disorders versus controls

  • Quantify expression differences across brain regions and developmental stages

• Colocalization studies:

  • Combine EFHC2 antibodies with markers for neuronal subtypes, glia, and synaptic proteins

  • Use confocal microscopy to determine cellular and subcellular localization patterns

  • Alexa Fluor 555-conjugated antibodies are particularly useful for multicolor imaging

• Functional impact assessment:

  • Use antibodies to immunoprecipitate EFHC2 and identify binding partners

  • Study calcium signaling pathways (given the EF-hand domains) in neuronal cell models

  • Investigate potential roles in microtubule dynamics as suggested for related proteins

• Patient-derived models:

  • Compare EFHC2 expression and localization in iPSC-derived neurons from patients with relevant disorders

  • Correlate molecular findings with electrophysiological phenotypes

What is the significance of EFHC2 as an autoantibody target in COVID-19, and how can researchers investigate this connection?

Recent research has identified anti-EFHC2 antibodies as potential biomarkers in COVID-19 patients . To investigate this connection:

• Autoantibody screening:

  • Use proteome-wide autoantibody screening (PWAbS) to detect anti-EFHC2 antibodies in patient sera

  • Employ ELISA with recombinant EFHC2 to validate PWAbS findings

  • Compare levels across disease severity groups and over the course of infection

• Longitudinal analysis:

  • Monitor anti-EFHC2 antibody levels at both early (within 10 days of symptom onset) and late timepoints (11-20 days)

  • Research indicates anti-EFHC2 antibody levels rise over time in COVID-19 patients, particularly in mild cases

• Cross-reactivity assessment:

  • Investigate potential molecular mimicry between SARS-CoV-2 proteins and EFHC2

  • Analyze if anti-EFHC2 antibodies correlate with antibodies against viral particles (N, S, RBD)

  • Current data suggests no correlation between anti-EFHC2 antibodies and anti-SARS-CoV-2 antibodies

• Machine learning approaches:

  • Apply XGBoost or similar algorithms to identify autoantibody signatures including EFHC2

  • Use ROC curve analysis to determine sensitivity (reported as 79%) and specificity (87%) of anti-EFHC2 antibodies as COVID-19 biomarkers

What are common technical challenges when working with EFHC2 antibodies and how can they be addressed?

Researchers frequently encounter these challenges when working with EFHC2 antibodies:

• Non-specific binding in Western blots:

  • Solution: Increase blocking time/concentration or try different blocking agents

  • Use more stringent washing conditions with increased salt concentration

  • Optimize antibody dilution (recommended range: 0.04-0.4 μg/ml)

• Weak signal in IHC applications:

  • Solution: Ensure proper antigen retrieval (HIER pH 6.0 is recommended)

  • Consider signal amplification systems if needed

  • Optimize antibody concentration (1:500-1:1000 dilution recommended)

• Variability between lot numbers:

  • Solution: Request validation data specific to each lot

  • Perform side-by-side testing when transitioning to a new lot

  • Consider using monoclonal antibodies for higher consistency

• Cross-reactivity with EFHC1:

  • Solution: Check immunogen sequence against EFHC1

  • Validate in systems where EFHC1 and EFHC2 are differentially expressed

  • Use EFHC2-specific epitopes that don't share homology with EFHC1

How can I evaluate whether an EFHC2 antibody is detecting the correct protein in my experiments?

A multi-faceted validation approach should include:

• Molecular weight verification:

  • Expected size for EFHC2 is approximately 84 kDa by Western blot

  • Compare with recombinant EFHC2 protein as a positive control

• Peptide competition assays:

  • Pre-incubate antibody with excess immunizing peptide

  • Specific staining should be abolished or significantly reduced

• Gene silencing validation:

  • Use siRNA or CRISPR to knock down EFHC2 expression

  • Confirm decreased signal corresponds with decreased expression

• Orthogonal detection methods:

  • Correlate protein detection with mRNA expression by RT-PCR

  • Use multiple antibodies targeting different epitopes of EFHC2

  • Consider mass spectrometry validation of immunoprecipitated protein

• Species cross-reactivity assessment:

  • Test in human, mouse, and rat samples (with 76-80% sequence identity to human)

  • Be aware that some antibodies have limited cross-reactivity

How might EFHC2 antibodies be utilized in studying calcium signaling pathways in neurological disorders?

EFHC2 contains three calcium-binding EF-hand motifs, suggesting a role in calcium signaling. Research approaches could include:

• Calcium imaging coupled with immunocytochemistry:

  • Use calcium indicators (Fluo-4, GCaMP) in conjunction with EFHC2 immunostaining

  • Correlate calcium dynamics with EFHC2 localization in neurons

  • Implement live-cell imaging following calcium stimulation

• Protein interaction network analysis:

  • Use co-immunoprecipitation with EFHC2 antibodies to pull down interaction partners

  • Identify calcium-dependent binding partners under various calcium concentrations

  • Map EFHC2 to known calcium signaling pathways in neurons

• Structure-function studies:

  • Generate antibodies specific to the EF-hand domains

  • Use domain-specific antibodies to block calcium binding in functional assays

  • Correlate calcium binding with protein localization and function

• Disease model investigation:

  • Compare calcium-dependent EFHC2 interactions in models of epilepsy or Turner syndrome

  • Investigate whether disease-associated mutations affect calcium binding

  • Assess calcium handling in patient-derived cells with altered EFHC2 expression

What experimental approaches can resolve contradictory findings regarding EFHC2's potential role in epilepsy?

The literature suggests possible associations between EFHC2 and juvenile myoclonic epilepsy, but findings have been inconsistent. To address contradictions:

• Population-specific genetic analysis:

  • Use targeted sequencing of EFHC2 in well-characterized epilepsy cohorts

  • Analyze X-chromosome inactivation patterns in female patients

  • Compare findings across different ethnic populations

• Functional characterization of variants:

  • Express wild-type and mutant EFHC2 in neuronal models

  • Use antibodies to assess protein stability, localization, and interaction partners

  • Measure electrophysiological parameters in models expressing variants

• Differential isoform analysis:

  • Develop isoform-specific antibodies

  • Determine if specific isoforms show stronger disease associations

  • Evaluate isoform expression patterns across brain regions and development

• Animal model studies:

  • Generate conditional EFHC2 knockout models

  • Use antibodies to confirm knockout efficiency

  • Evaluate seizure susceptibility and electrophysiological parameters

• Integration with EFHC1 research:

  • Compare and contrast with EFHC1, which has stronger epilepsy associations

  • Investigate potential compensatory mechanisms between these related proteins

  • Examine double knockout/knockdown models

How can EFHC2 antibodies be employed in COVID-19 autoimmunity research?

Recent research has identified anti-EFHC2 antibodies as potential biomarkers in COVID-19 patients. Experimental approaches include:

• Multiplex autoantibody profiling:

  • Integrate EFHC2 into autoantibody panels for COVID-19 patients

  • Use machine learning approaches like XGBoost to identify autoantibody signatures

  • Compare autoantibody profiles across disease severity groups and over time

• Mechanistic studies:

  • Investigate whether patient-derived anti-EFHC2 antibodies affect EFHC2 function

  • Assess impact on calcium signaling and neurological symptoms in COVID-19

  • Use recombinant EFHC2 to deplete patient sera and evaluate pathogenic effects

• Clinical correlations:

  • Monitor anti-EFHC2 antibody levels in patients with long COVID

  • Correlate with neurological manifestations

  • Establish timeline of autoantibody development and persistence

• Therapeutic explorations:

  • Test whether removal of anti-EFHC2 antibodies impacts clinical outcomes

  • Investigate molecular targets for preventing autoantibody production

  • Develop EFHC2-based decoys to neutralize pathogenic autoantibodies

What methodological approaches can help resolve the tissue-specific functions of EFHC2 across different cell types?

EFHC2 is expressed in various tissues, but its function may differ across cell types. To address this:

• Single-cell analysis:

  • Combine EFHC2 antibody staining with single-cell transcriptomics

  • Map cell type-specific expression patterns in complex tissues

  • Correlate with functional markers for cell-specific roles

• Conditional knockout approaches:

  • Generate cell type-specific EFHC2 knockout models

  • Use immunohistochemistry with EFHC2 antibodies to confirm knockout efficiency

  • Assess phenotypic changes in specific cell populations

• Proximity labeling techniques:

  • Develop EFHC2-BioID or APEX2 fusion proteins

  • Identify cell type-specific interaction partners

  • Map differential protein networks across tissues

• Subtractive immunoprecipitation:

  • Use EFHC2 antibodies to immunoprecipitate from different tissues

  • Compare interactomes to identify tissue-specific binding partners

  • Correlate with tissue-specific functions

Human Protein Atlas data indicates EFHC2 expression in multiple tissues, with notable expression in the central nervous system but also in peripheral tissues, suggesting diverse functions that warrant targeted investigation .