efnb2a Antibody

Shipped with Ice Packs
In Stock

Description

Definition and Target Specificity

Ephrin-B2 (EFNB2) antibodies are designed to bind the EFNB2 protein, which regulates cell-cell communication through interactions with EphB receptors (notably EphB4). EFNB2 is expressed in endothelial cells, tumor vasculature, and neural tissues, where it modulates angiogenesis, tumor progression, and synaptic plasticity .

Key Epitopes and Cross-Reactivity

  • AF496 (R&D Systems): A goat polyclonal antibody targeting the extracellular domain (Arg27-Ala227) of human, mouse, and rat EFNB2. It detects a ~40–45 kDa band in Western blot (WB) and shows minimal cross-reactivity with other ephrins .

  • HPA008999 (Sigma-Aldrich): A rabbit polyclonal antibody raised against a synthetic peptide (YRRRHRKHSPQHTTTLSLSTLATPKRSGNNNGSEPSDIIIPLRTADSVFCPHYEKVSGDYGHPVYIVQEMP). It exhibits cross-reactivity with ephrin-B1 and -B3 due to high sequence homology .

  • Phospho-Ephrin B (Tyr324/329) #3481 (Cell Signaling): Detects phosphorylated EFNB2, critical for studying reverse signaling .

Applications in Research

EFNB2 antibodies are employed across diverse experimental models:

ApplicationAntibody ExampleKey Findings
Western BlotAF496Confirmed EFNB2 expression in mouse embryo lysates and SH-SY5Y neuroblastoma cells .
Immunohistochemistry (IHC)HPA008999Identified EFNB2 overexpression in oral squamous cell carcinoma (OSCC), correlating with advanced clinical stage .
Flow CytometryAF496Demonstrated surface EFNB2 expression on SH-SY5Y cells .
Functional StudiesN/AEFNB2 activation in PB-MNCs enhanced diabetic ischemic limb revascularization .

Role in Cancer

  • Tumor Suppression vs. Angiogenesis: EFNB2 forward signaling (via EphB4) suppresses ovarian cancer proliferation, while reverse signaling promotes endothelial cell angiogenesis .

  • Metastasis: EFNB2 upregulation in colorectal liver metastases drives tumor growth via EphB4 interaction. Blocking EphB4 with siRNA or NVP-BHG712 reversed this effect .

  • Multiple Myeloma: EFNB2 reverse signaling enhances STAT5 activation, promoting tumor survival. Inhibition reduced myeloma engraftment in mice .

Neurological Implications

  • Synaptic Plasticity: EFNB2 clustering in hippocampal neurons is disrupted by anti-NMDA receptor antibodies, implicating it in autoimmune encephalitis .

Therapeutic Targeting

  • BIDEN-AP Peptide: A dual-function EphB4 agonist suppressed ovarian cancer invasion and angiogenesis by activating Crk1 signaling and blocking EFNB2 reverse signaling .

  • Diabetes: EFNB2-activated PB-MNCs restored angiogenesis in diabetic mice, highlighting its regenerative potential .

Limitations and Considerations

  • Cross-Reactivity: HPA008999 binds ephrin-B1/B3, necessitating validation with knockout controls .

  • Phospho-Specificity: Antibodies like #3481 require stimulation (e.g., EphB4 binding) to detect phosphorylated Tyr324/329 .

Clinical Relevance

  • Prognostic Value: High EFNB2 expression in OSCC predicts reduced 5-year survival . In multiple myeloma, elevated EFNB2 correlates with adverse outcomes .

  • Therapeutic Development: EFNB2-targeted agents (e.g., BIDEN-AP) are in preclinical testing for cancer and ischemic diseases .

Product Specs

Buffer
Preservative: 0.03% Proclin 300
Constituents: 50% Glycerol, 0.01M PBS, pH 7.4
Form
Liquid
Lead Time
Made-to-order (14-16 weeks)
Synonyms
efnb2a antibody; efnb2Ephrin-B2a antibody
Target Names
efnb2a
Uniprot No.

Target Background

Function
Ephrin-B2a is a cell surface transmembrane ligand that interacts with Eph receptors, a family of receptor tyrosine kinases crucial for cell migration, repulsion, and adhesion during neuronal, vascular, and epithelial development. Ephrin-B2a exhibits promiscuous binding to Eph receptors on adjacent cells, triggering contact-dependent bidirectional signaling. This signaling involves both forward signaling downstream of the Eph receptor and reverse signaling downstream of the ephrin ligand. Ephrin-B2a, in conjunction with EphB4, may play a critical role in heart morphogenesis and angiogenesis by regulating cell adhesion and migration.
Gene References Into Functions
  1. Notch1 activation induces the expression of ephrin B2a (efnb2a) and neuregulin 1 (nrg1) in the endocardium, promoting trabeculation. Notably, forced Notch activation in the absence of cardiac contraction rescues efnb2a and nrg1 expression. PMID: 26628092
  2. Research has identified ephrinB2a as a target of the hypoxia-inducible factor 1 (HIF1) pathway activation. Knockdown of ephrinB2a rescued guidance errors, and the receptor ephA4a was found to be expressed in a pattern complementary to the misrouted axons. PMID: 22511881
  3. Somite expression of known vascular guidance cues, efnb2, sema3a2, and plexinD1, is disrupted. This suggests that the inter-somitic vessel vascular phenotype is due to disruptions in these cues. PMID: 21038448
  4. EphrinB2a may signal to a subpopulation of retinal ganglion cell (RGC) axons that they have reached their target neurons in the tectum. PMID: 15007827
  5. EphrinB2a plays a crucial role in increasing the probability of neurons projecting to rhombomere 2 through a reverse signaling mechanism. PMID: 17507550
  6. Data indicates that EfnB2a is essential in the developing hindbrain for normal cell affinity. EphA4 and EfnB2a regulate cell affinity independently within their respective rhombomeres. PMID: 19135438
  7. The first embryonic vein forms through selective sprouting of progenitor cells from a precursor vessel, followed by vessel segregation. These processes are regulated by EphrinB2 and EphB4, which are expressed in arterial-fated and venous-fated progenitors, respectively. PMID: 19815777

Show More

Hide All

Database Links

KEGG: dre:30219

STRING: 7955.ENSDARP00000010432

UniGene: Dr.75819

Protein Families
Ephrin family
Subcellular Location
Cell membrane; Single-pass type I membrane protein.

Q&A

What is Ephrin-B2 and why is it significant in research?

Ephrin-B2 (EFNB2) is a transmembrane protein encoded by the EFNB2 gene with a reported amino acid length of 333 and an expected molecular mass of 36.9 kDa. It functions as a ligand for Eph receptors, a family of receptor tyrosine kinases crucial for migration, repulsion, and adhesion during neuronal, vascular, and epithelial development . Ephrin-B2 is involved in bidirectional signaling—the pathway downstream of the receptor is called forward signaling, while the pathway downstream of the ephrin ligand is referred to as reverse signaling .

Ephrin-B2 is significant in research due to its essential roles in:

  • Cardiovascular development and angiogenesis

  • Neural crest cell migration and development

  • Somite patterning during embryogenesis

  • Synaptic plasticity in the nervous system

  • Viral entry mechanisms (acts as a receptor for henipaviruses like Nipah virus)

The protein may also be known by alternative names including EPLG5, HTKL, Htk-L, LERK5, HTK ligand, and LERK-5 .

What applications are commonly supported by commercial Ephrin-B2 antibodies?

Commercial Ephrin-B2 antibodies support multiple experimental applications, as summarized in the following table:

ApplicationCommon DilutionsExpected OutcomesExamples of Use
Western Blot (WB)1:1000-1:400040-50 kDa bandsProtein expression levels in tissues/cells
Immunocytochemistry (ICC)1:50-1:500Cell surface localizationSubcellular localization studies
Immunofluorescence (IF)1:50-1:500Membrane staining patternsExpression in neural or vascular tissues
Immunohistochemistry (IHC)1:100-1:500Tissue-specific expressionDevelopmental or pathological studies
Flow CytometryVaries by antibodyCell surface expressionQuantification in cell populations
Immunoprecipitation (IP)2-5 μg/mLProtein isolationStudying protein interactions

When selecting antibodies for these applications, researchers should consider the validation data provided by manufacturers and published literature demonstrating successful application in similar experimental contexts .

How should researchers optimize Western blot protocols for Ephrin-B2 detection?

Optimizing Western blot protocols for Ephrin-B2 detection requires attention to several critical parameters:

Sample preparation:

  • Use RIPA or NP-40 buffer with protease and phosphatase inhibitors for efficient membrane protein extraction

  • For phosphorylation studies, include sodium orthovanadate to inhibit phosphatases

Electrophoresis and transfer:

  • Use 10-12% SDS-PAGE gels for optimal separation

  • PVDF membranes are recommended for transmembrane proteins like Ephrin-B2

  • Consider semi-dry transfer or overnight wet transfer at low voltage for efficient membrane protein transfer

Detection conditions:

  • Primary antibody concentration: Typically 1 μg/mL (range: 0.1-2 μg/mL) depending on the specific antibody

  • Incubation: Overnight at 4°C for optimal binding

  • Expected band size: Approximately 40-45 kDa, though glycosylation may result in higher apparent molecular weights (47-50 kDa)

Controls and troubleshooting:

  • Include positive control lysates (mouse embryo tissue or neuronal cell lines like SH-SY5Y)

  • For phosphorylation studies, compare phosphorylated vs. non-phosphorylated samples (e.g., before/after stimulation)

  • Pre-adsorption with immunizing peptide can confirm antibody specificity

What strategies improve reproducibility when working with Ephrin-B2 antibodies?

Ensuring reproducible results with Ephrin-B2 antibodies requires systematic approaches to antibody validation and experimental design:

Antibody validation strategies:

  • Cross-validation with multiple antibodies targeting different epitopes

  • Testing in knockout/knockdown models as negative controls

  • Peptide competition assays to confirm specificity

  • Batch testing and documentation to monitor lot-to-lot variations

Experimental considerations:

  • Standardize sample collection and processing protocols

  • Establish consistent fixation methods for immunostaining (fixation can affect epitope availability)

  • Document detailed protocols including blocking conditions, antibody concentrations, and incubation times

  • Include appropriate positive and negative controls in every experiment

Data analysis approaches:

  • Implement quantitative methods for signal analysis

  • Use consistent normalization strategies

  • Maintain detailed records of antibody sources, catalog numbers, and lot information

  • Consider blind analysis to reduce bias in subjective assessments

How can researchers distinguish between forward and reverse Ephrin-B2 signaling?

Differentiating between forward and reverse Ephrin-B2 signaling requires specialized experimental approaches:

For forward signaling analysis (Eph receptor-expressing cells):

  • Monitor Eph receptor phosphorylation using phospho-specific antibodies

  • Track downstream effectors such as Rho GTPases, focal adhesion kinase, or MAPK pathways

  • Use EphB receptor mutants that can bind Ephrin-B2 but lack kinase activity

  • Employ specific inhibitors (e.g., PI 3-kinase inhibitor LY29004 or MEK-1/2 inhibitors) to block specific pathways

For reverse signaling analysis (Ephrin-B2-expressing cells):

  • Track Ephrin-B2 tyrosine phosphorylation using phospho-specific antibodies (e.g., anti-phospho Y316)

  • Examine SH2/SH3 adapter protein recruitment to the Ephrin-B2 cytoplasmic domain

  • Utilize Ephrin-B2 mutants lacking cytoplasmic tyrosine phosphorylation sites

  • Assess PDZ-dependent signaling pathways through co-immunoprecipitation studies

Experimental systems:

  • Co-culture systems with cells expressing either Eph receptors or Ephrin-B2

  • In vivo models with cell-type specific knockout of either the receptor or ligand

  • Stimulation with clustered soluble Eph-Fc or Ephrin-Fc fusion proteins

What approaches are effective for studying Ephrin-B2's role in neural crest cell development?

Investigating Ephrin-B2's function in neural crest cells requires multi-dimensional approaches:

Genetic manipulation strategies:

  • Conditional knockout using neural crest-specific Cre lines (e.g., Nav1.8-Cre)

  • Temporal control using inducible systems (CreERT2)

  • Generation of chimeric embryos to assess cell-autonomous effects

Expression analysis methods:

  • Immunofluorescence co-labeling with neural crest markers (Sox10, FoxD3)

  • In situ hybridization for efnb2 mRNA expression

  • RT-PCR analysis to detect Eph receptor expression in neural crest populations

  • Single-cell RNA-seq to identify subpopulations expressing Ephrin-B2

Functional assessment:

  • Migration assays to evaluate neural crest movement

  • Lineage tracing combined with Ephrin-B2 manipulation

  • Assessment of derivative tissues (craniofacial structures, peripheral nervous system)

  • Live imaging of neural crest migration in Ephrin-B2 mutants

Research has demonstrated that loss of ephrin-B2 leads to defects in populations of cranial and trunk neural crest cells, highlighting its importance in early embryonic development .

What methodological approaches can evaluate Ephrin-B2 phosphorylation status?

Assessment of Ephrin-B2 phosphorylation requires specialized techniques:

Direct detection methods:

  • Phospho-specific antibodies targeting known phosphorylation sites (e.g., Y316)

  • Immunoprecipitation followed by Western blot with anti-phosphotyrosine antibodies

  • Phos-tag SDS-PAGE to enhance separation of phosphorylated from non-phosphorylated forms

  • Mass spectrometry for comprehensive identification of phosphorylation sites

Functional studies:

  • Mutation of key phosphorylation sites (e.g., tyrosine residues) to assess their functional importance

  • Use of kinase inhibitors to block phosphorylation events and confirm pathway specificity

  • Comparison of wild-type versus phosphorylation-deficient Ephrin-B2 in rescue experiments

In vivo approaches:

  • Generation of knock-in mice expressing phosphorylation site mutants

  • Phosphorylation analysis following physiological stimulation (e.g., after formalin injection in pain models)

  • Correlation of phosphorylation status with functional outcomes

Research has shown that NR2B phosphorylation in spinal cord is regulated by Ephrin-B2 signaling in certain inflammatory pain models, demonstrating the functional relevance of these phosphorylation events .

How can researchers engineer specific Ephrin-B2 variants for studying receptor selectivity?

Engineering Ephrin-B2 variants with modified receptor selectivity involves strategic approaches:

Mutagenesis strategies:

  • Deep mutational scanning to identify residues critical for specific receptor interactions

  • Structure-guided mutagenesis targeting the G-H binding loop of EFNB2

  • Creation of chimeric proteins with domains from different ephrins

Key residues for manipulation:

  • D62Q mutation enhances specificity for viral glycoproteins while reducing Eph receptor binding

  • Modifications at the base of the G-H binding loop affect receptor selectivity

  • Mutations in the phenylalanine hinge (F113) can alter conformational states

Validation approaches:

  • Surface plasmon resonance to measure binding kinetics with different receptors

  • Cell-based binding assays with flow cytometry readout

  • Functional assays to assess signaling outcomes with modified ligands

Combinatorial mutations (e.g., D62Q-Q130L-V167L) can create Ephrin-B2 variants with minimal binding to Eph receptors while maintaining interactions with viral glycoproteins, potentially useful for therapeutic applications .

What viral entry studies can be performed using Ephrin-B2 antibodies?

Ephrin-B2 antibodies enable diverse approaches to studying viral entry mechanisms:

Binding and competition assays:

  • Antibody blocking experiments to prevent viral attachment

  • Flow cytometry to quantify virus binding to Ephrin-B2-expressing cells

  • ELISA-based competition assays with recombinant viral proteins

Microscopy approaches:

  • Immunofluorescence co-localization of Ephrin-B2 with viral particles

  • Live-cell imaging of viral entry in the presence of blocking antibodies

  • Super-resolution microscopy to visualize virus-receptor interactions

Functional studies:

  • Viral infection assays in cells with antibody pre-treatment

  • Assessment of viral entry kinetics with receptor-specific antibodies

  • Combination of antibodies targeting different epitopes to map the viral binding interface

Ephrin-B2 serves as a cell entry receptor for several henipaviruses including Nipah virus, and understanding these interactions has implications for developing antiviral strategies .

How should researchers approach Ephrin-B2 antibody validation across different species?

Cross-species validation of Ephrin-B2 antibodies requires systematic assessment:

Sequence analysis:

  • Alignment of Ephrin-B2 sequences across species to identify conserved epitopes

  • Mapping of antibody epitopes to assess theoretical cross-reactivity

  • Analysis of post-translational modification sites that might affect antibody recognition

Experimental validation:

  • Western blot testing using recombinant proteins or tissue lysates from multiple species

  • Immunohistochemistry on fixed tissues from different species with known expression patterns

  • Negative controls using tissues from knockout models

Optimization strategies:

  • Titration of antibody concentrations for each species

  • Modified fixation protocols that preserve epitopes across species

  • Adjusted blocking conditions to reduce background in different tissue types

Many commercial antibodies are validated for human, mouse, and rat Ephrin-B2 , but validation for other species requires careful testing by individual researchers.

How can Ephrin-B2 antibodies be utilized in angiogenesis research?

Ephrin-B2 antibodies offer valuable tools for investigating angiogenic processes:

Expression analysis in vascular tissues:

  • Immunostaining of developing vascular beds to map arterial-venous boundaries

  • Co-localization with endothelial markers in tumor vasculature

  • Quantification of Ephrin-B2 levels during vascular remodeling

Functional manipulation:

  • Blocking antibodies to inhibit Ephrin-B2/EphB4 interactions during sprouting angiogenesis

  • Tracking phosphorylation events in tip vs. stalk cells during vessel formation

  • Analysis of cellular responses (migration, adhesion) following antibody treatment

In vivo applications:

  • Injection of fluorescently-labeled antibodies for vascular imaging

  • Therapeutic targeting of pathological angiogenesis with blocking antibodies

  • Assessment of vascular normalization following treatment

Ephrin-B2 plays a central role in heart morphogenesis and angiogenesis through regulation of cell adhesion and migration, making it a valuable target for cardiovascular research .

What approaches can identify novel Ephrin-B2 binding partners beyond Eph receptors?

Discovering non-canonical Ephrin-B2 interactions requires specialized techniques:

Protein-protein interaction methods:

  • Immunoprecipitation coupled with mass spectrometry

  • Proximity labeling approaches (BioID, APEX)

  • Protein microarray screening with recombinant Ephrin-B2

  • Yeast two-hybrid screening using the Ephrin-B2 cytoplasmic domain

Validation strategies:

  • Co-immunoprecipitation with candidate interactors

  • Surface plasmon resonance to measure binding kinetics

  • Proximity ligation assay for in situ interaction detection

  • FRET or BRET assays in living cells

Functional assessment:

  • siRNA knockdown of candidate interactors followed by Ephrin-B2 pathway analysis

  • Co-expression studies in heterologous systems

  • Structure-function analysis with domain deletion mutants

Beyond Eph receptors, Ephrin-B2 has been identified as a receptor for henipaviruses and may have additional uncharacterized binding partners involved in its diverse biological functions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.