Ephrin-B2 (EFNB2) antibodies are designed to bind the EFNB2 protein, which regulates cell-cell communication through interactions with EphB receptors (notably EphB4). EFNB2 is expressed in endothelial cells, tumor vasculature, and neural tissues, where it modulates angiogenesis, tumor progression, and synaptic plasticity .
AF496 (R&D Systems): A goat polyclonal antibody targeting the extracellular domain (Arg27-Ala227) of human, mouse, and rat EFNB2. It detects a ~40–45 kDa band in Western blot (WB) and shows minimal cross-reactivity with other ephrins .
HPA008999 (Sigma-Aldrich): A rabbit polyclonal antibody raised against a synthetic peptide (YRRRHRKHSPQHTTTLSLSTLATPKRSGNNNGSEPSDIIIPLRTADSVFCPHYEKVSGDYGHPVYIVQEMP). It exhibits cross-reactivity with ephrin-B1 and -B3 due to high sequence homology .
Phospho-Ephrin B (Tyr324/329) #3481 (Cell Signaling): Detects phosphorylated EFNB2, critical for studying reverse signaling .
EFNB2 antibodies are employed across diverse experimental models:
Tumor Suppression vs. Angiogenesis: EFNB2 forward signaling (via EphB4) suppresses ovarian cancer proliferation, while reverse signaling promotes endothelial cell angiogenesis .
Metastasis: EFNB2 upregulation in colorectal liver metastases drives tumor growth via EphB4 interaction. Blocking EphB4 with siRNA or NVP-BHG712 reversed this effect .
Multiple Myeloma: EFNB2 reverse signaling enhances STAT5 activation, promoting tumor survival. Inhibition reduced myeloma engraftment in mice .
Synaptic Plasticity: EFNB2 clustering in hippocampal neurons is disrupted by anti-NMDA receptor antibodies, implicating it in autoimmune encephalitis .
BIDEN-AP Peptide: A dual-function EphB4 agonist suppressed ovarian cancer invasion and angiogenesis by activating Crk1 signaling and blocking EFNB2 reverse signaling .
Diabetes: EFNB2-activated PB-MNCs restored angiogenesis in diabetic mice, highlighting its regenerative potential .
Cross-Reactivity: HPA008999 binds ephrin-B1/B3, necessitating validation with knockout controls .
Phospho-Specificity: Antibodies like #3481 require stimulation (e.g., EphB4 binding) to detect phosphorylated Tyr324/329 .
Ephrin-B2 (EFNB2) is a transmembrane protein encoded by the EFNB2 gene with a reported amino acid length of 333 and an expected molecular mass of 36.9 kDa. It functions as a ligand for Eph receptors, a family of receptor tyrosine kinases crucial for migration, repulsion, and adhesion during neuronal, vascular, and epithelial development . Ephrin-B2 is involved in bidirectional signaling—the pathway downstream of the receptor is called forward signaling, while the pathway downstream of the ephrin ligand is referred to as reverse signaling .
Ephrin-B2 is significant in research due to its essential roles in:
Cardiovascular development and angiogenesis
Neural crest cell migration and development
Somite patterning during embryogenesis
Synaptic plasticity in the nervous system
Viral entry mechanisms (acts as a receptor for henipaviruses like Nipah virus)
The protein may also be known by alternative names including EPLG5, HTKL, Htk-L, LERK5, HTK ligand, and LERK-5 .
Commercial Ephrin-B2 antibodies support multiple experimental applications, as summarized in the following table:
When selecting antibodies for these applications, researchers should consider the validation data provided by manufacturers and published literature demonstrating successful application in similar experimental contexts .
Optimizing Western blot protocols for Ephrin-B2 detection requires attention to several critical parameters:
Sample preparation:
Use RIPA or NP-40 buffer with protease and phosphatase inhibitors for efficient membrane protein extraction
For phosphorylation studies, include sodium orthovanadate to inhibit phosphatases
Electrophoresis and transfer:
Use 10-12% SDS-PAGE gels for optimal separation
PVDF membranes are recommended for transmembrane proteins like Ephrin-B2
Consider semi-dry transfer or overnight wet transfer at low voltage for efficient membrane protein transfer
Detection conditions:
Primary antibody concentration: Typically 1 μg/mL (range: 0.1-2 μg/mL) depending on the specific antibody
Incubation: Overnight at 4°C for optimal binding
Expected band size: Approximately 40-45 kDa, though glycosylation may result in higher apparent molecular weights (47-50 kDa)
Controls and troubleshooting:
Include positive control lysates (mouse embryo tissue or neuronal cell lines like SH-SY5Y)
For phosphorylation studies, compare phosphorylated vs. non-phosphorylated samples (e.g., before/after stimulation)
Pre-adsorption with immunizing peptide can confirm antibody specificity
Ensuring reproducible results with Ephrin-B2 antibodies requires systematic approaches to antibody validation and experimental design:
Antibody validation strategies:
Cross-validation with multiple antibodies targeting different epitopes
Testing in knockout/knockdown models as negative controls
Peptide competition assays to confirm specificity
Batch testing and documentation to monitor lot-to-lot variations
Experimental considerations:
Standardize sample collection and processing protocols
Establish consistent fixation methods for immunostaining (fixation can affect epitope availability)
Document detailed protocols including blocking conditions, antibody concentrations, and incubation times
Include appropriate positive and negative controls in every experiment
Data analysis approaches:
Implement quantitative methods for signal analysis
Use consistent normalization strategies
Maintain detailed records of antibody sources, catalog numbers, and lot information
Consider blind analysis to reduce bias in subjective assessments
Differentiating between forward and reverse Ephrin-B2 signaling requires specialized experimental approaches:
For forward signaling analysis (Eph receptor-expressing cells):
Monitor Eph receptor phosphorylation using phospho-specific antibodies
Track downstream effectors such as Rho GTPases, focal adhesion kinase, or MAPK pathways
Use EphB receptor mutants that can bind Ephrin-B2 but lack kinase activity
Employ specific inhibitors (e.g., PI 3-kinase inhibitor LY29004 or MEK-1/2 inhibitors) to block specific pathways
For reverse signaling analysis (Ephrin-B2-expressing cells):
Track Ephrin-B2 tyrosine phosphorylation using phospho-specific antibodies (e.g., anti-phospho Y316)
Examine SH2/SH3 adapter protein recruitment to the Ephrin-B2 cytoplasmic domain
Utilize Ephrin-B2 mutants lacking cytoplasmic tyrosine phosphorylation sites
Assess PDZ-dependent signaling pathways through co-immunoprecipitation studies
Experimental systems:
Co-culture systems with cells expressing either Eph receptors or Ephrin-B2
In vivo models with cell-type specific knockout of either the receptor or ligand
Stimulation with clustered soluble Eph-Fc or Ephrin-Fc fusion proteins
Investigating Ephrin-B2's function in neural crest cells requires multi-dimensional approaches:
Genetic manipulation strategies:
Conditional knockout using neural crest-specific Cre lines (e.g., Nav1.8-Cre)
Temporal control using inducible systems (CreERT2)
Generation of chimeric embryos to assess cell-autonomous effects
Expression analysis methods:
Immunofluorescence co-labeling with neural crest markers (Sox10, FoxD3)
In situ hybridization for efnb2 mRNA expression
RT-PCR analysis to detect Eph receptor expression in neural crest populations
Single-cell RNA-seq to identify subpopulations expressing Ephrin-B2
Functional assessment:
Migration assays to evaluate neural crest movement
Lineage tracing combined with Ephrin-B2 manipulation
Assessment of derivative tissues (craniofacial structures, peripheral nervous system)
Live imaging of neural crest migration in Ephrin-B2 mutants
Research has demonstrated that loss of ephrin-B2 leads to defects in populations of cranial and trunk neural crest cells, highlighting its importance in early embryonic development .
Assessment of Ephrin-B2 phosphorylation requires specialized techniques:
Direct detection methods:
Phospho-specific antibodies targeting known phosphorylation sites (e.g., Y316)
Immunoprecipitation followed by Western blot with anti-phosphotyrosine antibodies
Phos-tag SDS-PAGE to enhance separation of phosphorylated from non-phosphorylated forms
Mass spectrometry for comprehensive identification of phosphorylation sites
Functional studies:
Mutation of key phosphorylation sites (e.g., tyrosine residues) to assess their functional importance
Use of kinase inhibitors to block phosphorylation events and confirm pathway specificity
Comparison of wild-type versus phosphorylation-deficient Ephrin-B2 in rescue experiments
In vivo approaches:
Generation of knock-in mice expressing phosphorylation site mutants
Phosphorylation analysis following physiological stimulation (e.g., after formalin injection in pain models)
Correlation of phosphorylation status with functional outcomes
Research has shown that NR2B phosphorylation in spinal cord is regulated by Ephrin-B2 signaling in certain inflammatory pain models, demonstrating the functional relevance of these phosphorylation events .
Engineering Ephrin-B2 variants with modified receptor selectivity involves strategic approaches:
Mutagenesis strategies:
Deep mutational scanning to identify residues critical for specific receptor interactions
Structure-guided mutagenesis targeting the G-H binding loop of EFNB2
Creation of chimeric proteins with domains from different ephrins
Key residues for manipulation:
D62Q mutation enhances specificity for viral glycoproteins while reducing Eph receptor binding
Modifications at the base of the G-H binding loop affect receptor selectivity
Mutations in the phenylalanine hinge (F113) can alter conformational states
Validation approaches:
Surface plasmon resonance to measure binding kinetics with different receptors
Cell-based binding assays with flow cytometry readout
Functional assays to assess signaling outcomes with modified ligands
Combinatorial mutations (e.g., D62Q-Q130L-V167L) can create Ephrin-B2 variants with minimal binding to Eph receptors while maintaining interactions with viral glycoproteins, potentially useful for therapeutic applications .
Ephrin-B2 antibodies enable diverse approaches to studying viral entry mechanisms:
Binding and competition assays:
Antibody blocking experiments to prevent viral attachment
Flow cytometry to quantify virus binding to Ephrin-B2-expressing cells
ELISA-based competition assays with recombinant viral proteins
Microscopy approaches:
Immunofluorescence co-localization of Ephrin-B2 with viral particles
Live-cell imaging of viral entry in the presence of blocking antibodies
Super-resolution microscopy to visualize virus-receptor interactions
Functional studies:
Viral infection assays in cells with antibody pre-treatment
Assessment of viral entry kinetics with receptor-specific antibodies
Combination of antibodies targeting different epitopes to map the viral binding interface
Ephrin-B2 serves as a cell entry receptor for several henipaviruses including Nipah virus, and understanding these interactions has implications for developing antiviral strategies .
Cross-species validation of Ephrin-B2 antibodies requires systematic assessment:
Sequence analysis:
Alignment of Ephrin-B2 sequences across species to identify conserved epitopes
Mapping of antibody epitopes to assess theoretical cross-reactivity
Analysis of post-translational modification sites that might affect antibody recognition
Experimental validation:
Western blot testing using recombinant proteins or tissue lysates from multiple species
Immunohistochemistry on fixed tissues from different species with known expression patterns
Negative controls using tissues from knockout models
Optimization strategies:
Titration of antibody concentrations for each species
Modified fixation protocols that preserve epitopes across species
Adjusted blocking conditions to reduce background in different tissue types
Many commercial antibodies are validated for human, mouse, and rat Ephrin-B2 , but validation for other species requires careful testing by individual researchers.
Ephrin-B2 antibodies offer valuable tools for investigating angiogenic processes:
Expression analysis in vascular tissues:
Immunostaining of developing vascular beds to map arterial-venous boundaries
Co-localization with endothelial markers in tumor vasculature
Quantification of Ephrin-B2 levels during vascular remodeling
Functional manipulation:
Blocking antibodies to inhibit Ephrin-B2/EphB4 interactions during sprouting angiogenesis
Tracking phosphorylation events in tip vs. stalk cells during vessel formation
Analysis of cellular responses (migration, adhesion) following antibody treatment
In vivo applications:
Injection of fluorescently-labeled antibodies for vascular imaging
Therapeutic targeting of pathological angiogenesis with blocking antibodies
Assessment of vascular normalization following treatment
Ephrin-B2 plays a central role in heart morphogenesis and angiogenesis through regulation of cell adhesion and migration, making it a valuable target for cardiovascular research .
Discovering non-canonical Ephrin-B2 interactions requires specialized techniques:
Protein-protein interaction methods:
Immunoprecipitation coupled with mass spectrometry
Proximity labeling approaches (BioID, APEX)
Protein microarray screening with recombinant Ephrin-B2
Yeast two-hybrid screening using the Ephrin-B2 cytoplasmic domain
Validation strategies:
Co-immunoprecipitation with candidate interactors
Surface plasmon resonance to measure binding kinetics
Proximity ligation assay for in situ interaction detection
FRET or BRET assays in living cells
Functional assessment:
siRNA knockdown of candidate interactors followed by Ephrin-B2 pathway analysis
Co-expression studies in heterologous systems
Structure-function analysis with domain deletion mutants
Beyond Eph receptors, Ephrin-B2 has been identified as a receptor for henipaviruses and may have additional uncharacterized binding partners involved in its diverse biological functions .