ELMOD2 Antibody

What are the key cellular localizations of ELMOD2 protein?

ELMOD2 has been identified in multiple cellular compartments, primarily localizing to mitochondria, endoplasmic reticulum (ER), and lipid droplets (LDs). Immunoelectron microscopy using anti-GFP antibodies has confirmed that GFP-ELMOD2 distributes on the LD surface, and similar distribution patterns were observed in the ER and mitochondria . This multi-compartment localization suggests diverse roles for ELMOD2 in cellular functions across these organelles, which researchers should consider when designing experiments targeting specific cellular processes .

What is the molecular weight of ELMOD2 and how does this impact antibody-based detection?

ELMOD2 is a ~32 kDa protein (~293 amino acids) as calculated from its sequence, though it is frequently observed at approximately 35-37 kDa in Western blot applications . This discrepancy between calculated and observed molecular weights is important for researchers to note when interpreting Western blot results. When validating an ELMOD2 antibody, confirmation of a band in this range is essential. Additionally, researchers should be aware that post-translational modifications, particularly palmitoylation which anchors ELMOD2 to lipid droplets, may affect the protein's migration pattern in gel electrophoresis .

What is the primary enzymatic activity of ELMOD2?

ELMOD2 functions as a GTPase-activating protein (GAP) with uniquely broad specificity toward ARF family GTPases. It was first purified based on its GAP activity toward ARL2 and later demonstrated to have GAP activity toward multiple GTPases including Arf1, Arl2, Arf3, and Arf6 in vitro . This GAP activity hydrolyzes GTP to GDP, thereby inactivating these GTPases. Experimental evidence using pull-down assays with GST-GGA3 (which binds to the GTP form but not the GDP form of Arf1) showed increased Arf1-HA precipitation in ELMOD2 siRNA-treated cells, confirming that endogenous ELMOD2 functions as a GAP for Arf1 in cellular contexts .

What are the optimal dilutions for different ELMOD2 antibody applications?

These dilutions should be optimized for each experimental system, as factors including cell type, fixation method, and protein expression levels can influence optimal antibody concentration .

How can researchers verify ELMOD2 antibody specificity?

Verification of ELMOD2 antibody specificity should employ multiple approaches:

• RNA interference validation: Knockdown ELMOD2 using siRNA and confirm reduced signal intensity in Western blotting. Studies have shown that the specificity of anti-ELMOD2 antibodies can be confirmed by a marked decrease in reaction intensity when ELMOD2 is knocked down with RNA interference .

• Tagged protein expression: Express tagged versions of ELMOD2 (e.g., GFP-ELMOD2, ELMOD2-V5, ELMOD2-myc) and confirm antibody detection at the expected molecular weight. Previous research demonstrated that antibodies reacted with expressed ELMOD2 tagged with GFP at the N-terminus and ELMOD2 tagged with V5 at the C-terminus at the expected regions of the gel .

• Molecular replacement approach: For mutational studies, deplete endogenous ELMOD2 with siRNA and then transfect with siRNA-resistant ELMOD2 cDNAs to confirm specificity of phenotypic effects .

• Cross-validation with different antibodies: Use multiple antibodies targeting different epitopes of ELMOD2 to confirm consistent localization and expression patterns .

What sample preparation techniques are critical for ELMOD2 detection in different cellular compartments?

For effective detection of ELMOD2 across its multiple cellular localizations, specialized preparation techniques are required:

• Lipid droplet isolation: For studying ELMOD2 in lipid droplets, use either sucrose density-gradient ultracentrifugation or differential ultracentrifugation. Western blotting confirmed ELMOD2 detection in LD fractions obtained by both methods .

• Subcellular fractionation: When investigating ELMOD2 distribution across compartments, differential ultracentrifugation effectively separates microsomal and mitochondrial fractions containing ELMOD2 .

• Immunofluorescence preparation: Since some anti-ELMOD2 antibodies may not work effectively in immunofluorescence labeling, consider using tagged versions (GFP-ELMOD2 or ELMOD2-V5) for visualization studies .

• Fixation methods: For immunohistochemistry applications, antigen retrieval with TE buffer pH 9.0 is suggested, though citrate buffer pH 6.0 can be used as an alternative .

How can ELMOD2 knockout models be generated and validated for functional studies?

Creating effective ELMOD2 knockout models requires strategic approaches:

• CRISPR/Cas9 targeting strategy: Target near the 5' end of the open reading frame and upstream of the sole catalytic ELMO domain. This approach ensures that any protein fragments made from the mutated ELMOD2 gene will likely be inactive and potentially degraded rapidly .

• Multiple independent knockout lines: Generate multiple cell lines using different guide RNAs to protect against off-target effects that can occur with CRISPR. Research has successfully employed this approach with 10 independently cloned knockout lines .

• Validation protocols:

  • Perform genomic DNA sequencing after PCR amplification of the targeted region

  • Maintain "CRISPR WT" clones that have been through identical transfection, selection, and cloning processes as controls

  • Create rescue cell lines by transducing knockout lines with lentiviruses expressing ELMOD2-myc to confirm phenotype reversal

• Functional validation: Screen for anticipated phenotypes related to ELMOD2 functions, such as mitochondrial fragmentation or changes in lipid droplet dynamics .

What are the critical considerations when investigating ELMOD2's role in mitochondrial fusion?

When studying ELMOD2's role in mitochondrial dynamics, researchers should consider:

• Mitofusin-dependent effects: ELMOD2 regulates mitochondrial fusion in a mitofusin-dependent manner. Expression of ELMOD2 partially reverses mitochondrial fragmentation in MFN1- and MFN2-null MEFs. Experimental designs should include appropriate mitofusin knockout models to fully characterize this relationship .

• Species-specific considerations: Human and mouse ELMOD2 share 87% identity in primary sequence, but human ELMOD2 contains a high percentage of rare codons (53% compared to 15% in mouse ELMOD2), which may contribute to its lower expression levels in experimental systems. When rescuing knockout of ELMOD2 in mouse cells, mouse ELMOD2-myc achieved substantially higher expression than human ELMOD2 .

• ARL2 interaction: There are several parallels between ARL2 and ELMOD2 in mitochondrial dynamics. Both localize to mitochondria, and siRNA knockdown of either causes mitochondrial fragmentation and perinuclear clustering. Consider investigating both proteins simultaneously to understand their interconnected roles .

• Quantification parameters: When assessing mitochondrial morphology changes, establish clear criteria for categorizing mitochondrial networks as tubular, intermediate, or fragmented to ensure consistent phenotypic scoring across experiments .

How can researchers effectively investigate ELMOD2's palmitoylation and its impact on lipid droplet localization?

For studying ELMOD2 palmitoylation and its functional significance:

• Cysteine substitution approach: Create mutants where cysteine residues are replaced to prevent palmitoylation. Research has shown that replacing all five cysteine residues in GFP-ELMOD2 (−5Cys) significantly reduced its accumulation around LDs, while replacement of one or two cysteines did not cause obvious changes in distribution .

• Compartment-specific analysis: Note that while palmitoylation is crucial for ELMOD2's LD localization, GFP-ELMOD2 (−5Cys) still distributed in the ER and mitochondria, indicating different targeting mechanisms for different compartments .

• Functional consequences: Measure effects of palmitoylation-deficient mutants on:

  • ATGL recruitment to LDs

  • Cellular TAG content

  • LD number and size

  Previous studies demonstrated that knockdown of ELMOD2 caused a significant decrease in cellular TAG content and both the number and size of LDs were significantly decreased .

• Rescue experiments: Utilize siRNA-resistant ELMOD2 cDNA transfection to determine whether phenotypic effects of ELMOD2 knockdown can be reversed, thus excluding off-target effects of siRNA .

How can researchers address issues with ELMOD2 detection in immunofluorescence studies?

When facing challenges in ELMOD2 immunofluorescence detection:

• Alternative visualization approaches: Some anti-ELMOD2 antibodies don't work effectively in immunofluorescence labeling. Consider using tagged versions such as GFP-ELMOD2 or ELMOD2-V5, which have been successfully used to visualize ELMOD2 localization .

• Expression optimization: Human ELMOD2 contains a high percentage of rare codons (53%) compared to mouse ELMOD2 (15%), which may contribute to its low expression levels. When expression is critical, consider using mouse ELMOD2 constructs or codon-optimized human sequences .

• Fixation protocol optimization: Test multiple fixation methods, as ELMOD2's localization to multiple compartments (mitochondria, ER, lipid droplets) may require specialized fixation protocols to preserve all localization patterns simultaneously .

• Antibody selection: Different commercial antibodies target different epitopes - for instance, Proteintech's antibody (13027-1-AP) targets the full-length fusion protein, while Sigma's antibody targets a specific sequence (KATHVVQSEVDKYVDDIMKEKNINPEKDASFKICMKMCLLQITGYKQLYLDVESVRKRPYDSDNLQ). Epitope accessibility may vary between applications and cellular compartments .

What strategies can resolve issues with specificity and background in ELMOD2 Western blotting?

To optimize ELMOD2 Western blotting:

• Blocking optimization: Test different blocking agents (BSA vs. non-fat milk) as different antibodies may perform optimally with different blockers. The Proteintech antibody (13027-1-AP) protocol specifies blocking with non-fat milk, while others may have different requirements .

• Validated positive controls: Use cell lines with confirmed ELMOD2 expression. According to validation data, A549, HeLa, HepG2, and Jurkat cells all express detectable levels of ELMOD2 .

• Antibody concentration titration: While recommended dilutions range from 1:500 to 1:4000 for Western blotting, optimal dilution should be determined empirically for each experimental system and antibody lot .

• Sample preparation considerations: For membrane-associated proteins like ELMOD2 that undergo palmitoylation, ensure lysis buffers effectively solubilize the protein without disrupting epitope recognition. Include appropriate detergents and consider the impact of reducing agents on palmitoylated proteins .

How should researchers interpret variations in ELMOD2 molecular weight across different experimental systems?

When facing molecular weight variations:

• Expected vs. observed weight: ELMOD2 has a calculated molecular weight of approximately 32-35 kDa but is often observed at 37 kDa in Western blot applications. This discrepancy is normal and should be considered when interpreting results .

• Post-translational modifications: ELMOD2 undergoes palmitoylation, which can affect its migration pattern. Additionally, other potential modifications may occur depending on cellular context and stress conditions .

• Species differences: When comparing human and mouse ELMOD2, note the 87% sequence identity may result in slight differences in molecular weight or antibody reactivity. Human ELMOD2 contains a higher percentage of rare codons, which may also impact expression levels and potentially post-translational processing .

• Splice variants consideration: While not extensively documented in the provided search results, potential splice variants should be considered when unexpected bands appear, especially when studying ELMOD2 across different tissues or cell types .

How can researchers differentiate between ELMOD2's direct effects and indirect consequences through its GAP activity?

To distinguish direct vs. indirect effects:

• GAP-dead mutants: Generate ELMOD2 mutants that lack GAP activity but maintain proper localization. Compare phenotypes between wild-type and GAP-dead mutants to determine which effects require GAP activity versus protein-protein interactions .

• GTPase mutant co-expression: Co-express constitutively active (GTP-locked) or inactive (GDP-locked) forms of ELMOD2's target GTPases (ARL2, ARF1, ARF6) to determine whether phenotypes can be mimicked or rescued independent of ELMOD2 .

• Pathway-specific assays: Implement assays that specifically measure downstream effects of individual GTPases. For example:

  • ARF1: Measure COPI recruitment to membranes

  • ARL2: Assess microtubule dynamics

  • ARF6: Evaluate cytokinesis progression

  This approach helps identify which GTPase pathway mediates specific ELMOD2 functions .

• Temporal analyses: Use inducible expression or degradation systems to determine the immediate versus long-term consequences of ELMOD2 activity, helping separate direct effects from adaptive responses .

What is the significance of ELMOD2's multi-compartmental localization for interpreting functional studies?

The complex localization pattern of ELMOD2 presents specific interpretational challenges:

• Compartment-specific functions: ELMOD2 has demonstrated distinct roles in different cellular compartments:

  • Mitochondria: Regulates mitochondrial fusion with ARL2 and mitofusins

  • Lipid droplets: Controls recruitment of ATGL through ARF1-COPI machinery

  • Other locations: May have additional, undocumented functions

• Isolation of compartment-specific effects: Use targeted ELMOD2 constructs with compartment-specific targeting sequences to restrict expression to individual organelles, allowing isolation of location-specific functions .

• Conditional knockout approaches: Consider tissue-specific or inducible knockout models to distinguish between developmental versus acute effects of ELMOD2 loss across different cellular compartments .

• Integrated analysis: Recognize that changes in one compartment may indirectly affect others. For example, mitochondrial dysfunction resulting from ELMOD2 loss might alter lipid metabolism, indirectly affecting lipid droplet dynamics .

How should researchers interpret contradictory findings about ELMOD2's roles in different cellular processes?

When facing contradictory results:

• Cell type specificity: Different cell types may utilize ELMOD2 in unique ways. For example, ELMOD2's role in lipid droplet dynamics may be more prominent in hepatocytes than in fibroblasts, while its mitochondrial functions may be universal .

• Compensation mechanisms: In long-term knockout studies, other ELMOD proteins (particularly ELMOD1, an important paralog) may partially compensate for ELMOD2 loss, masking phenotypes that would be evident in acute depletion experiments .

• Substrate specificity variations: While ELMOD2 has been shown to act on multiple GTPases in vitro, its in vivo specificity may be regulated by cellular context, interaction partners, or post-translational modifications .

• Experimental approach differences: Contradictions may arise from differences in:

  • Detection methods (antibody vs. tagged protein visualization)

  • Knockout/knockdown approaches (CRISPR vs. siRNA)

  • Expression systems (transient vs. stable)

  • Species differences (human vs. mouse ELMOD2)

• Integration with other pathways: Consider ELMOD2's involvement in multiple pathways simultaneously. For instance, its roles in both mitochondrial fusion and lipid metabolism may represent integrated cellular responses rather than independent functions .

What are the emerging techniques for studying ELMOD2's role in pulmonary fibrosis pathogenesis?

Advanced approaches for investigating ELMOD2 in pulmonary fibrosis include:

• Patient-derived cell models: Develop primary cell cultures or induced pluripotent stem cells (iPSCs) from patients with ELMOD2 mutations associated with familial idiopathic pulmonary fibrosis to study disease mechanisms in relevant cell types .

• Tissue-specific conditional knockout models: Generate lung epithelium-specific ELMOD2 knockout mice to assess organ-specific consequences without developmental complications or compensatory mechanisms present in global knockouts .

• High-resolution imaging approaches: Implement super-resolution microscopy techniques to visualize ELMOD2's dynamic interactions with mitochondria, ER, and other cellular structures during fibrotic processes .

• Multi-omics integration: Combine transcriptomics, proteomics, and metabolomics analyses of ELMOD2-deficient lung tissues to comprehensively map dysregulated pathways contributing to fibrosis development .

• Therapeutic targeting approaches: Develop strategies to modulate ELMOD2 function or expression as potential therapeutic interventions for pulmonary fibrosis, particularly focusing on compartment-specific activities .

How can researchers effectively investigate ELMOD2's potential roles in antiviral responses?

For exploring ELMOD2's antiviral functions:

• Virus challenge models: Compare viral replication kinetics in ELMOD2 knockout versus wild-type cells challenged with different virus families to identify virus-specific responses .

• Interaction with innate immune signaling: Examine potential interactions between ELMOD2 and key components of antiviral signaling pathways, such as RIG-I-like receptors, type I interferon signaling, or inflammasome activation .

• Subcellular redistribution during infection: Monitor changes in ELMOD2 localization during viral infection using time-lapse microscopy with fluorescently tagged ELMOD2 to identify potential recruitment to sites of viral replication or assembly .

• Virus-induced post-translational modifications: Investigate whether viral infection alters ELMOD2 palmitoylation, phosphorylation, or other modifications that might regulate its function during infection .

• Interactome analysis during infection: Perform immunoprecipitation followed by mass spectrometry to identify novel ELMOD2 interaction partners that emerge specifically during viral infection .

What methodological approaches can uncover the relationship between ELMOD2 and other ELMOD family proteins?

To investigate relationships between ELMOD family members:

• Comparative localization studies: Systematically compare subcellular localization patterns of all ELMOD proteins (ELMOD1-3) using consistent tagging strategies and cell models to identify unique versus overlapping distributions .

• Cross-complementation experiments: Test whether overexpression of other ELMOD proteins can rescue phenotypes in ELMOD2-deficient cells to assess functional redundancy versus specialization .

• Domain swap approaches: Create chimeric proteins exchanging domains between different ELMOD family members to map determinants of subcellular targeting and substrate specificity .

• Combinatorial knockout models: Generate cell lines or animal models with combinations of ELMOD proteins deleted to uncover potential compensatory mechanisms or synergistic functions .

• Evolutionary analysis: Perform comparative genomics across species to trace the evolution of ELMOD protein functions and identify conserved versus divergent properties that might inform functional specialization .