ERCC5 Antibody

What is ERCC5 and why is it important in research?

ERCC5 (also known as XPG) is a critical endonuclease that makes the 3' incision during DNA nucleotide excision repair. It belongs to the FEN1/XPG family of endonucleases and plays a crucial role in removing UV-induced DNA damage . Beyond its primary role in NER, ERCC5 also functions in base excision repair (BER) by promoting DNA glycosylase NTHL1 binding and activity, participates in transcription-coupled repair (TCR), maintains DNA replication fork stability, and contributes to homologous recombination repair (HRR) . Mutations in ERCC5 cause xeroderma pigmentosum complementation group G, characterized by UV hypersensitivity and increased skin cancer risk . Recent research shows ERCC5 expression correlates with cancer outcomes, making it an important research target for both DNA repair mechanisms and cancer biology .

What subcellular localization should researchers expect when using ERCC5 antibodies?

ERCC5 protein is predominantly localized in the nucleus, consistent with its function in DNA repair mechanisms . When performing immunocytochemistry or immunohistochemistry with ERCC5 antibodies, researchers should observe primary nuclear staining patterns. In immunohistochemistry studies of hepatocellular carcinoma tissues, ERCC5 protein has been detected primarily in the nuclear compartment . Unexpected cytoplasmic localization may indicate either antibody cross-reactivity, a specific cellular context where ERCC5 has cytoplasmic functions, or potentially a splice variant. Researchers should validate unexpected localization patterns using multiple antibodies targeting different epitopes and complementary techniques such as subcellular fractionation followed by Western blotting .

What are the main ERCC5 protein variants researchers should be aware of?

The main functional ERCC5 protein is encoded by the ERCC5 gene, but researchers should be aware of the BIVM-ERCC5 readthrough transcript that produces a fusion protein between BIVM and ERCC5 . This readthrough transcription exists between ERCC5 and the neighboring upstream BIVM gene (basic, immunoglobulin-like variable motif containing) . When selecting or designing antibodies, researchers should consider whether they want to detect all ERCC5 variants or specifically distinguish between the standard ERCC5 protein and the BIVM-ERCC5 fusion protein. The functional differences between these variants remain an active area of research, and antibodies specific to unique regions of each variant would be valuable tools for investigating their distinct roles .

What validation methods should be employed when using ERCC5 antibodies?

Validation of ERCC5 antibodies should follow a multi-method approach:

• Western blot validation: Perform Western blot analysis on a panel of tissues and cell lines known to express ERCC5. Look for bands of predicted size (approximately 133 kDa for the full-length protein) .

• Enhanced validation techniques:

  • siRNA knockdown: Compare staining intensity between control and ERCC5-silenced cells

  • Tagged GFP cell lines: Evaluate signal overlap between antibody staining and GFP-tagged ERCC5

  • Independent antibodies validation: Compare staining patterns of two or more antibodies targeting different ERCC5 epitopes

• Protein array analysis: Use arrays containing the ERCC5 antigen among other proteins to test antibody specificity .

• Immunocytochemistry/Immunohistochemistry: Validate subcellular localization in cell lines with known ERCC5 expression patterns .

Antibodies should be scored as "Enhanced," "Supported," "Approved," or "Uncertain" based on their performance across these validation methods .

What are optimal fixation and antigen retrieval methods for ERCC5 immunohistochemistry?

For optimal ERCC5 immunohistochemistry:

The choice between citrate and EDTA buffers should be empirically determined for each specific ERCC5 antibody. Some epitopes may be better retrieved with one buffer versus the other. Researchers should always include positive control tissues (e.g., normal liver) where ERCC5 expression has been well-documented .

How should researchers quantify ERCC5 expression in immunohistochemistry studies?

For consistent and reproducible quantification of ERCC5 expression in tissue samples:

• Immunoreactive scoring system (IRS): Calculate by multiplying staining intensity score (0-3) by percentage of positive cells score (0-4):

  • Intensity: 0 (negative), 1 (weak), 2 (moderate), 3 (strong)

  • Percentage: 0 (0%), 1 (1-25%), 2 (26-50%), 3 (51-75%), 4 (76-100%)

  • Final IRS score ranges from 0-12

• Cutoff determination: In HCC studies, an IRS score ≥4 has been used to define "high expression" .

• Digital image analysis: Use software-based quantification methods for more objective assessment.

• Multiple observer scoring: Have at least two independent observers score slides to ensure reliability.

• Statistical analysis: For survival analysis, use Kaplan-Meier curves with log-rank tests to analyze differences between high and low ERCC5 expression groups .

This quantification approach was successfully employed in studies demonstrating that high ERCC5 expression correlates with poor prognosis in hepatocellular carcinoma patients .

How can ERCC5 antibodies be used to study DNA repair mechanisms?

ERCC5 antibodies can provide valuable insights into various DNA repair mechanisms:

• Co-localization studies: Use ERCC5 antibodies in conjunction with antibodies against other DNA repair proteins (RAD51, BRCA2, PALB2) to study their co-localization at DNA damage sites using confocal microscopy .

• Chromatin immunoprecipitation (ChIP): Employ ERCC5 antibodies to isolate chromatin fragments where ERCC5 is bound, revealing its genomic binding sites during repair processes.

• Proximity ligation assay (PLA): Detect protein-protein interactions between ERCC5 and other repair factors in situ at damaged DNA sites.

• Immunoprecipitation coupled with mass spectrometry: Identify novel ERCC5 interaction partners following various DNA damage treatments.

• Live-cell imaging: Use ERCC5 antibodies conjugated to cell-permeable fluorescent tags to track ERCC5 recruitment to DNA damage sites in real time.

These applications help elucidate ERCC5's multifunctional role in nucleotide excision repair, base excision repair, transcription-coupled repair, and homologous recombination repair pathways .

What is the prognostic significance of ERCC5 expression in cancer research?

Studies utilizing ERCC5 antibodies have revealed significant prognostic correlations in cancer:

• Hepatocellular carcinoma (HCC): High ERCC5 expression is significantly associated with poor prognosis in HCC patients .

Researchers studying cancer biomarkers should consider including ERCC5 in their antibody panels for prognostic studies, particularly in cancers where DNA repair deficiencies are implicated in disease progression .

How can ERCC5 antibodies help investigate resistance mechanisms to DNA-damaging therapies?

ERCC5 antibodies can be instrumental in studying therapy resistance mechanisms:

• Expression correlation: Measure ERCC5 protein levels before and after treatment with DNA-damaging agents to identify adaptive responses.

• Patient stratification: Use ERCC5 expression patterns to categorize patients who might respond differently to therapies like platinum compounds or trabectedin that target DNA repair pathways .

• Combination with genetic analysis: Couple protein expression studies with analysis of ERCC5 single nucleotide polymorphisms (SNPs) that may affect protein function and treatment response .

• Therapies targeting NER: Investigate whether tumors with high ERCC5 expression might be more sensitive to agents that create lesions specifically repaired by nucleotide excision repair.

• Resistance biomarker panels: Develop multi-antibody panels including ERCC5, ERCC1, and BRCA1 to create comprehensive DNA repair capacity profiles that predict therapy response .

Research has indicated that specific SNPs in ERCC5/XPG, ERCC1, and BRCA1 may be associated with sensitivity to certain chemotherapeutic agents in patients with soft tissue sarcoma .

How should researchers address discrepancies between ERCC5 mRNA and protein expression data?

When encountering discrepancies between ERCC5 mRNA and protein levels:

• Post-transcriptional regulation: Investigate microRNA regulation of ERCC5 mRNA that might affect translation efficiency.

• Protein stability factors: Examine whether protein stabilization or degradation mechanisms differ between samples, affecting protein half-life despite similar mRNA levels.

• Antibody epitope accessibility: Consider whether protein modifications or interactions might mask epitopes in certain contexts, leading to false negative results despite protein presence.

• Splice variants: Determine whether primers and antibodies are targeting the same isoforms. The readthrough transcription between BIVM and ERCC5 genes can produce fusion proteins that might be detected differently at mRNA versus protein levels .

• Technical validation: Perform technical replicates using independent methodologies (qPCR vs. RNA-seq for mRNA; different antibodies or mass spectrometry for protein detection).

Previous studies have primarily focused on either mRNA or protein levels, with protein-level studies showing clearer associations with clinical outcomes in cancer research .

What controls are essential when using ERCC5 antibodies in functional studies?

For robust functional studies using ERCC5 antibodies:

• Positive expression controls: Include cell lines with confirmed high ERCC5 expression (e.g., certain HCC cell lines) .

• Negative controls:

  • Primary antibody omission

  • ERCC5 knockdown cells (siRNA/shRNA)

  • Isotype-matched irrelevant antibody

• Antibody validation controls:

  • Peptide competition assays

  • Western blot confirmation of specificity

  • Multiple independent antibodies targeting different ERCC5 epitopes

• Functional controls:

  • UV irradiation to trigger DNA damage response and ERCC5 recruitment

  • DNA damaging agents known to engage NER pathway

• Signal specificity controls:

  • Titration of antibody concentration to determine optimal signal-to-noise ratio

  • Testing different antigen retrieval methods to optimize epitope detection

These controls help ensure that observed signals genuinely reflect ERCC5 biology rather than technical artifacts or cross-reactivity.

How can researchers identify and mitigate potential cross-reactivity with ERCC5 antibodies?

To address potential cross-reactivity issues with ERCC5 antibodies:

• Epitope analysis: Review the antibody's target epitope for sequence similarity with other human proteins. The search results indicate that for designing single-target antigens, a maximum identity of 60% is allowed .

• Sliding window identity check: Assess sequence identity using sliding windows of 10 aa residues (HsID 10) or 50 aa residues (HsID 50) to identify regions with minimal homology to other proteins .

• Antigen selection strategy:

  • Target regions with unique ERCC5 sequences

  • Avoid highly conserved functional domains shared by other XPG/FEN1 family members

  • Consider the amino acid sequence: "DDFSQYQLKGLLKKNYLNQHIEHVQKEMNQQHSGHIRRQYEDEGGFLKEV" as a potential antigen region with lower cross-reactivity potential

• Validation in ERCC5-null systems: Test antibodies in cell lines where ERCC5 has been knocked out using CRISPR/Cas9 to confirm signal absence.

• Western blot profile: Look for additional unexpected bands that might indicate cross-reactivity with other proteins.

Proper control of cross-reactivity is essential, particularly when studying ERCC5 in the context of other DNA repair proteins with similar structural domains or when differentiating between ERCC5 and the BIVM-ERCC5 readthrough product .

What role do ERCC5 antibodies play in studying the intersection of DNA repair and cancer immunotherapy?

ERCC5 antibodies are becoming increasingly important in investigating connections between DNA repair deficiency and immune responses:

• Neoantigen generation: DNA repair defects, including those in ERCC5-mediated pathways, can increase mutation load and potentially generate neoantigens. Antibodies can help characterize repair-deficient tumors that might respond better to immunotherapy.

• DNA damage response and immune signaling: Use ERCC5 antibodies alongside immune markers to study how DNA repair defects trigger immune signaling pathways like the cGAS-STING pathway.

• Biomarker panels: Develop combined immunohistochemistry panels including ERCC5 and immune infiltrate markers to better stratify patients for immunotherapy.

• Therapy response prediction: Correlate ERCC5 expression patterns with response to combination treatments involving DNA-damaging agents and immune checkpoint inhibitors.

• Microenvironment studies: Use multiplex immunofluorescence with ERCC5 antibodies to study interactions between DNA repair-deficient tumor cells and immune cells in the tumor microenvironment.

This emerging research area may help identify patients who would benefit from combined approaches targeting both DNA repair and immune pathways.

How can researchers optimize ERCC5 antibodies for detecting specific protein interactions and complexes?

For studying ERCC5 protein interactions and complexes:

• Proximity-dependent labeling: Combine ERCC5 antibodies with techniques like BioID or APEX to identify proteins in close proximity to ERCC5 during DNA repair.

• Native complex preservation: Optimize gentle lysis conditions that maintain ERCC5-containing complexes for co-immunoprecipitation studies.

• Cross-linking immunoprecipitation (CLIP): Use UV cross-linking before immunoprecipitation with ERCC5 antibodies to capture transient interactions.

• Antibody epitope selection: Choose antibodies targeting regions of ERCC5 that are not involved in protein-protein interactions to avoid interference with complex formation.

• Post-translational modification-specific antibodies: Develop phospho-specific or other modification-specific ERCC5 antibodies to distinguish functionally distinct ERCC5 populations.

These approaches can help elucidate how ERCC5 interacts with proteins like ERCC6/CSB in transcription-coupled repair, with NTHL1 in base excision repair, and with RAD51, BRCA2, and PALB2 in homologous recombination repair .