ERP4 Antibody

What is ERP44 and what are its key biological functions?

ERP44 (also known as PDIA10 or TXNDC4) is a critical component of the endoplasmic reticulum (ER) quality control system. It ensures proper protein folding and prevents the accumulation of misfolded proteins that can be toxic to cells. ERP44 facilitates correct protein formation through its interactions with the ER machinery and helps maintain cellular homeostasis. Dysregulation of ERP44 function has been implicated in several pathological conditions, including neurodegenerative disorders, diabetes, and cancer, making it an important target for research across multiple disease models .

What technical specifications should researchers know about ERP44 antibodies?

Commercially available ERP44 antibodies, such as the Rabbit Polyclonal Antibody (CAB4526), are typically generated using recombinant fusion proteins containing specific amino acid sequences of human ERP44. For example, amino acids 57-406 of human ERP44 (NP_055866.1) may serve as the immunogen. These antibodies generally demonstrate reactivity across multiple species including human, mouse, and rat samples. The isotype is commonly IgG, and validated applications typically include Western blot (WB) and ELISA techniques .

What is the recommended starting point for ERP44 detection in experimental samples?

For Western blot applications, the recommended initial dilution range for ERP44 antibodies is typically 1:500 to 1:2000. For optimal results, researchers should include positive control samples such as HeLa cell lysates, which are known to express detectable levels of ERP44. When designing experiments, it's advisable to run optimization tests with different dilutions to determine the ideal concentration for specific experimental conditions and sample types .

How can researchers distinguish between ERP44 and other PDI family members in experimental studies?

Distinguishing ERP44 from other protein disulfide isomerase (PDI) family members requires careful antibody selection and experimental design. Researchers should:

• Select antibodies raised against unique regions of ERP44 that do not share significant homology with other PDI family proteins

• Implement knockdown/knockout controls to verify antibody specificity

• Consider using multiple antibodies targeting different epitopes of ERP44

• Perform immunoprecipitation followed by mass spectrometry to confirm protein identity

• Include recombinant ERP44 protein standards alongside experimental samples

The amino acid sequence of ERP44 includes distinctive regions that can serve as antibody targets for specific detection. The sequence "WCRFSQMLHPIFEEESDVIKEEFPNENQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNG..." represents a unique fingerprint that can be used for developing specific antibody-based detection methods .

What experimental approaches are recommended for studying ERP44's role in protein folding and quality control?

To investigate ERP44's function in protein folding and quality control, researchers should consider:

• Co-immunoprecipitation studies to identify ERP44 binding partners

• Pulse-chase experiments to track protein maturation and degradation rates

• Cell stress induction (e.g., tunicamycin treatment) to observe ERP44 responses

• CRISPR/Cas9-mediated knockout or knockdown models to assess loss-of-function effects

• Fluorescence microscopy with co-localization studies to visualize ER interactions

• Protein aggregation assays under conditions of ERP44 modulation

These approaches can provide mechanistic insights into how ERP44 participates in the complex process of protein quality control within the endoplasmic reticulum.

How should researchers design experiments to study ERP44's involvement in disease mechanisms?

When investigating ERP44's role in disease pathogenesis, consider these experimental designs:

• Compare ERP44 expression levels between patient-derived samples and controls using the validated antibody dilutions (1:500-1:2000 for Western blot)

• Develop cell or animal models with altered ERP44 expression to mimic disease conditions

• Examine downstream effects of ERP44 dysregulation on cellular stress responses

• Perform temporal studies to track ERP44 changes during disease progression

• Utilize tissue-specific approaches to understand context-dependent functions of ERP44

• Create rescue experiments to demonstrate causality between ERP44 dysfunction and disease phenotypes

What are the critical parameters for successful Western blot detection of ERP44?

For optimal Western blot detection of ERP44:

• Sample preparation: Use lysis buffers containing appropriate protease inhibitors to prevent degradation

• Protein loading: Load 20-50 μg of total protein per well

• Separation: Use 8-10% SDS-PAGE gels for proper resolution of ERP44 (~44 kDa)

• Transfer: Optimize transfer conditions for high molecular weight proteins

• Blocking: Use 5% non-fat milk or BSA in TBST for 1 hour at room temperature

• Primary antibody: Apply ERP44 antibody at 1:500-1:2000 dilution and incubate overnight at 4°C

• Secondary antibody: Use species-appropriate HRP-conjugated secondary antibody

• Detection: Employ enhanced chemiluminescence for visualization

What troubleshooting approaches should be used for inconsistent ERP44 antibody results?

When encountering inconsistent results with ERP44 antibody detection:

• Verify protein extraction efficiency using alternative lysis methods

• Test multiple antibody concentrations beyond the standard 1:500-1:2000 range

• Extend blocking time to reduce background signal

• Adjust incubation temperature and duration for primary antibody

• Implement epitope retrieval techniques if working with fixed tissues

• Compare results across multiple antibody lots and vendors

• Include positive control samples (e.g., HeLa cells) alongside experimental samples

• Consider native vs. denaturing conditions if protein conformation affects epitope accessibility

How can researchers quantitatively assess ERP44 expression levels?

For quantitative assessment of ERP44 expression:

• Implement proper loading controls (e.g., β-actin, GAPDH)

• Use standard curves with recombinant ERP44 protein

• Apply densitometry software for signal quantification

• Employ qRT-PCR to correlate protein levels with mRNA expression

• Consider multiplexed approaches such as Wes™ or Jess™ automated Western systems

• Utilize ELISA for quantification of ERP44 in complex samples

• Implement flow cytometry for single-cell level quantification

• Apply mass spectrometry for absolute quantification in complex samples

How is ERP44 implicated in neurodegenerative disease research?

ERP44's role in neurodegenerative diseases stems from its critical function in protein quality control. Misfolded proteins are a hallmark of many neurodegenerative conditions, including Alzheimer's, Parkinson's, and Huntington's diseases. When studying these connections, researchers should:

• Assess ERP44 expression patterns in affected brain regions

• Investigate interactions between ERP44 and disease-specific proteins (e.g., amyloid-β, α-synuclein)

• Evaluate ER stress markers in relation to ERP44 function

• Study the effects of ERP44 modulation on neuronal survival

• Explore potential protective roles of ERP44 upregulation

Dysregulation of ERP44 function has been implicated in neurodegenerative disorders, making this protein a valuable target for understanding disease mechanisms and identifying therapeutic strategies .

What experimental approaches link ERP44 to cancer biology?

To investigate ERP44's role in cancer:

• Compare ERP44 expression across cancer cell lines and corresponding normal tissues

• Correlate ERP44 levels with cancer progression and patient outcomes

• Examine how ERP44 affects cancer cell proliferation, migration, and invasion

• Study the relationship between ERP44 and the unfolded protein response in cancer cells

• Investigate whether targeting ERP44 sensitizes cancer cells to therapy

• Analyze how hypoxia and other cancer microenvironment factors influence ERP44 function

Understanding ERP44's role in cancer could provide insights into novel therapeutic approaches, as dysregulation of this protein has been implicated in cancer development and progression .

How can ERP44 research contribute to understanding autoimmune conditions?

While the search results focus primarily on LRP4 antibodies in myasthenia gravis rather than ERP44 directly, this approach illustrates how protein-specific antibodies can contribute to autoimmune disease research:

• Screen patient sera for autoantibodies against ERP44

• Characterize pathogenic mechanisms if ERP44 autoantibodies are detected

• Develop animal models through immunization with ERP44 or passive transfer of purified antibodies

• Study whether autoantibodies affect ERP44 function or localization

• Investigate tissue-specific manifestations of autoimmune responses against ERP44

Similar to studies with LRP4 antibodies in myasthenia gravis , this methodological approach could be applied to investigate potential autoimmune responses against ERP44 in various conditions.