The EXOC3L1 antibody (Product ID: HPA029574) is a polyclonal rabbit-derived antibody produced by Sigma-Aldrich as part of their Prestige Antibodies® line. Key specifications include:
Host species: Rabbit
Conjugate: Unconjugated
Form: Affinity-isolated antibody in buffered aqueous glycerol solution
Reactivity: Human-specific
Applications: Immunohistochemistry (1:200–1:500 dilution)
Immunogen sequence: A 123-amino acid peptide (MGSLELGPEADVSQLEPLLTLENIEQLEATFVANIQASVSQWLQNALDGEVAEWGREHGPNTDPSGSYYSPMPAIVLQILEENIRVASLVSESLQQRVHGMALSELGTFLRSFSDALIRFSRDHFRGKSMAPHYVPYL) .
EXOC3L1 is overexpressed in ESCC and correlates with poor clinical outcomes:
| Parameter | ESCC Association |
|---|---|
| N stage | Positive correlation (lymph node metastasis) |
| Pathologic stage | Significant association |
| Immune infiltration | Linked to CD8+ T cells, dendritic cells, and regulatory T cells |
The exocyst complex, including EXOC3L1, is essential for constitutive secretion:
Knockout studies: CRISPR-Cas9 KO of EXOC3 in HeLa cells reduced secretion of soluble proteins (e.g., TIMP2, CST3) by >50% .
Professional secretory cells:
EXOC3L1 exhibits differential expression across 33 tumor types (TCGA data):
Upregulated: ESCC, glioblastoma, and pancreatic adenocarcinoma.
Immune correlations: Positive associations with B cells, macrophages, and CD4+/CD8+ T cells in multiple cancers .
| Cancer Type | Immune Correlation |
|---|---|
| ESCC | Activated dendritic cells (r = 0.32) |
| Lung adenocarcinoma | Cytotoxic cells (r = 0.28) |
| Breast cancer | Th1 cells (r = 0.24) |
The antibody has been validated through:
Protein Atlas: Immunohistochemical staining confirmed EXOC3L1 localization in vascular endothelial cells and tumor stroma .
Functional assays: Used in loss-of-function studies to characterize EXOC3L1’s role in exocytosis .
EXOC3L1 antibody is critical for exploring:
EXOC3L1 (Exocyst complex component 3-like 1) is a protein-coding RNA located on chromosome 16 (16q22.1), also known as EXOC3L. It was originally identified as an isoform of Sec6 involved in insulin secretion regulation in pancreatic β cells . Recent research has revealed its significant overexpression in esophageal squamous cell carcinoma (ESCC) compared to normal tissues, with high expression correlating with worse prognosis . EXOC3L1 has demonstrated potential as a novel prognostic biomarker and therapeutic target in ESCC, particularly due to its association with lymph node metastasis (N stage) and pathologic stage . The protein's correlation with immune cell infiltration suggests its involvement in tumor immune microenvironment modulation, making it a compelling target for cancer immunotherapy research .
When selecting an anti-EXOC3L1 antibody, consider these methodological factors:
Validation status: Choose antibodies validated for your specific application (IHC, ICC-IF, WB) . Review validation data including positive/negative controls.
Species reactivity: Confirm the antibody recognizes EXOC3L1 in your experimental species. The antibody described in search result targets human EXOC3L1.
Epitope recognition: If studying specific domains or isoforms of EXOC3L1, verify the epitope region recognized by the antibody.
Polyclonal vs. monoclonal: Polyclonal antibodies (like the one in search result ) recognize multiple epitopes and may provide stronger signals, while monoclonals offer greater specificity for a single epitope.
Reproducibility: Assess the manufacturing process and quality control that ensures consistent lot-to-lot performance .
For ESCC or cancer-related research, select antibodies specifically validated in oncology applications, as EXOC3L1's role has been primarily characterized in ESCC contexts .
Optimizing EXOC3L1 detection requires tissue-specific protocol adjustments:
For IHC in ESCC tissues:
Fixation: 10% neutral buffered formalin for 24-48 hours
Antigen retrieval: Heat-induced epitope retrieval in citrate buffer (pH 6.0) for 20 minutes
Blocking: 5% normal serum for 1 hour at room temperature
Primary antibody: Incubate with anti-EXOC3L1 antibody (0.1 mg/ml) at 1:100-1:200 dilution overnight at 4°C
Detection: Use appropriate secondary antibody and visualization system based on your primary antibody species and detection method
Controls: Include both positive controls (ESCC tissue with confirmed high EXOC3L1 expression) and negative controls (normal esophageal tissue)
For Western blotting:
Protein extraction: Use RIPA buffer with protease inhibitors
Loading: 20-40 μg total protein per lane
Transfer: Semi-dry or wet transfer to PVDF membrane
Blocking: 5% non-fat milk for 1 hour at room temperature
Primary antibody: Incubate with anti-EXOC3L1 antibody at manufacturer-recommended dilution (typically 1:500-1:1000) overnight at 4°C
Visualization: Use chemiluminescence detection after HRP-conjugated secondary antibody incubation
For immunofluorescence (ICC-IF):
Fixation: 4% paraformaldehyde for 15 minutes
Permeabilization: 0.1% Triton X-100 for 10 minutes
Blocking: 1% BSA for 30 minutes
Primary antibody: Anti-EXOC3L1 at 1:50-1:100 dilution for 1-2 hours at room temperature
Secondary antibody: Fluorophore-conjugated appropriate secondary antibody
For accurate EXOC3L1 quantification in prognostic studies, employ a multi-modal approach:
RNA-seq quantification:
IHC scoring systems:
Implement H-score methodology (intensity × percentage of positive cells)
Use automated image analysis software for objective quantification
Score intensity on a scale (0-3) and calculate percentage of positive cells
Consider both nuclear and cytoplasmic staining patterns
Statistical validation:
Correlate expression with clinicopathological features using appropriate statistical tests
Perform ROC curve analysis to determine optimal cutoff values (AUC for EXOC3L1 in ESCC was 0.812)
Use Kaplan-Meier survival analysis with log-rank test to assess prognostic significance
Conduct univariate and multivariate Cox regression analyses to determine independent prognostic value
Quality control measures:
Researchers commonly encounter these challenges with EXOC3L1 antibodies:
Cross-reactivity issues:
Problem: Non-specific binding to related exocyst complex proteins
Solution: Perform antibody validation with positive and negative controls, including EXOC3L1 knockdown/knockout samples
Approach: Use competition assays with recombinant EXOC3L1 protein to confirm specificity
Variable signal strength:
Problem: Inconsistent staining intensity between experiments
Solution: Standardize all protocol parameters (fixation times, antigen retrieval conditions, antibody concentrations)
Approach: Include internal reference controls in each experiment to normalize signal intensity
Limited tissue penetration:
Problem: Poor antibody penetration in thicker tissue sections
Solution: Optimize section thickness (4-5 μm recommended), extend antibody incubation times, or use specialized permeabilization protocols
Approach: Consider amplification methods like tyramide signal amplification for low-abundance targets
Background staining:
Problem: High background obscuring specific signals
Solution: Increase blocking time/concentration, optimize antibody dilution, and include additional washing steps
Approach: Use specialized blocking reagents that address tissue-specific background issues
Epitope masking:
Problem: Fixation-induced epitope masking
Solution: Evaluate multiple antigen retrieval methods (heat-induced vs. enzymatic)
Approach: Test different pH conditions (pH 6.0 citrate buffer vs. pH 9.0 EDTA buffer)
Lot-to-lot variability:
Problem: Performance differences between antibody lots
Solution: Purchase larger lots when possible and validate each new lot against previous standards
Approach: Maintain reference samples and standardized protocols for comparative testing
A comprehensive validation strategy for anti-EXOC3L1 antibodies includes:
Genetic controls:
Perform siRNA/shRNA knockdown of EXOC3L1 to confirm signal reduction
Use CRISPR/Cas9-mediated knockout cells as negative controls
Overexpress EXOC3L1 in appropriate cell models to demonstrate signal increase
Multi-application concordance:
Verify consistent results across multiple applications (WB, IHC, ICC-IF)
Compare protein expression pattern with mRNA expression data
Confirm molecular weight in Western blot matches predicted size
Peptide competition assays:
Pre-incubate antibody with immunizing peptide or recombinant EXOC3L1
Demonstrate competitive reduction/elimination of specific signal
Include non-relevant peptide controls
Multiple antibody comparison:
Tissue panel analysis:
To investigate EXOC3L1's role in immune cell infiltration:
Multiplex immunofluorescence (mIF) studies:
Co-stain tissues with anti-EXOC3L1 antibody and markers for immune cells identified as significant in previous research: activated dendritic cells (aDCs), CD8+ T cells, cytotoxic cells, eosinophils, immature dendritic cells (iDCs), CD56dim Natural killer cells, T cells, Th1 cells, and regulatory T cells
Analyze co-localization patterns and spatial relationships
Quantify cell-to-cell distances and interaction frequencies
Flow cytometry applications:
Design multi-parameter panels including EXOC3L1 and immune cell markers
Sort EXOC3L1-high vs. EXOC3L1-low cells and perform comprehensive immune profiling
Analyze differences in immune populations associated with EXOC3L1 expression levels
Single-cell analysis workflows:
Integrate EXOC3L1 antibody staining with single-cell RNA sequencing
Map EXOC3L1 protein expression to transcriptional profiles of immune cells
Identify cell populations where EXOC3L1 expression correlates with immune function
Functional assays:
Use EXOC3L1 antibodies to neutralize or modulate protein function in co-culture systems
Assess changes in immune cell recruitment, activation, and function
Monitor cytokine production and immune checkpoint expression
In vivo imaging:
Develop conjugated EXOC3L1 antibodies for in vivo tracking
Visualize EXOC3L1-expressing cells and their interaction with immune infiltrates
Monitor dynamic changes in immune infiltration following therapeutic interventions
This approach aligns with research showing EXOC3L1 expression positively correlates with infiltration of several immune cell types in ESCC .
EXOC3L1 antibodies can advance cancer therapeutic research through:
Target validation studies:
Use antibodies to confirm EXOC3L1 overexpression in patient-derived xenografts and tissue microarrays
Correlate EXOC3L1 levels with response to standard therapies
Identify patient subgroups most likely to benefit from EXOC3L1-targeted approaches
Focus particularly on ESCC patients with lymph node metastasis, where EXOC3L1 shows significant correlation with N stage
Antibody-drug conjugate (ADC) development:
Engineer anti-EXOC3L1 antibodies conjugated to cytotoxic payloads
Optimize linker chemistry and payload selection
Evaluate specificity, internalization efficiency, and cytotoxic potency
Test ADCs in preclinical models of ESCC with varying EXOC3L1 expression levels
Combination therapy strategies:
Explore synergies between EXOC3L1 targeting and immune checkpoint inhibitors
Investigate EXOC3L1's role in PD-1 blockade response pathways identified in GSEA analysis
Develop rational combinations based on EXOC3L1's association with specific immune cell populations
Test combinatorial approaches in syngeneic mouse models
Biomarker implementation:
Develop standardized IHC protocols using validated anti-EXOC3L1 antibodies
Establish clinically relevant cutoffs for patient stratification
Create companion diagnostic assays for future EXOC3L1-targeting therapies
Implement in clinical trials to correlate expression with treatment outcomes
Mechanistic studies:
To investigate EXOC3L1's metabolic functions:
Pancreatic β-cell studies:
Use anti-EXOC3L1 antibodies to immunolocalize the protein in pancreatic islets
Study co-localization with insulin secretory granules and SNARE proteins
Investigate expression changes under diabetogenic conditions
Correlate EXOC3L1 expression with functional insulin secretion assays
Glucose stimulation experiments:
Monitor EXOC3L1 localization changes before and after glucose stimulation
Assess protein-protein interactions during insulin secretion using proximity ligation assays
Quantify differences in EXOC3L1 phosphorylation status under varying glucose concentrations
Determine EXOC3L1's temporal dynamics during biphasic insulin secretion
HDL metabolism investigations:
Examine EXOC3L1 expression in liver tissue using immunohistochemistry
Correlate tissue expression levels with serum HDL concentrations
Study EXOC3L1's potential interaction with HDL receptor complexes
Investigate its role in HDL-mediated cholesterol efflux pathways
Transgenic model analysis:
Generate tissue-specific EXOC3L1 knockout models
Use anti-EXOC3L1 antibodies to confirm deletion efficiency
Characterize metabolic phenotypes with emphasis on glucose homeostasis and lipid profiles
Perform rescue experiments with wild-type EXOC3L1
Therapeutic exploration:
Screen for compounds that modulate EXOC3L1 expression or function
Validate target engagement using anti-EXOC3L1 antibodies
Assess effects on insulin secretion and HDL metabolism
Develop antibody-based imaging tools to monitor therapy response
This research direction builds on EXOC3L1's established roles in insulin secretion and HDL concentration regulation , expanding its potential significance beyond cancer research.
To study EXOC3L1's interactions with exocyst complex components:
Co-immunoprecipitation (Co-IP) optimization:
Use anti-EXOC3L1 antibodies as bait to pull down interacting partners
Implement reciprocal Co-IPs with antibodies against other exocyst components
Optimize lysis conditions to preserve native protein complexes
Validate interactions using multiple antibodies targeting different epitopes
Analyze precipitates by mass spectrometry to identify novel interactors
Proximity-based interaction assays:
Implement BioID or APEX2 proximity labeling with EXOC3L1 as the bait
Use anti-EXOC3L1 antibodies to validate expression of fusion proteins
Apply FRET/BRET approaches to study dynamic interactions
Perform proximity ligation assays (PLA) in fixed cells or tissues
Quantify interaction signals under various cellular conditions
Super-resolution microscopy techniques:
Utilize STORM/PALM imaging with EXOC3L1 antibodies
Perform two-color super-resolution to visualize nanoscale proximity
Track co-localization dynamics during vesicle trafficking events
Quantify spatial relationships at exocytosis sites
Correlate structural arrangements with functional outcomes
Protein fragment complementation assays:
Design split reporter systems fused to EXOC3L1 and potential partners
Validate expression using anti-EXOC3L1 antibodies
Measure reconstituted activity under various cellular conditions
Map interaction domains through deletion mutants
Assess effects of disease-associated mutations on complex formation
Cross-linking mass spectrometry (XL-MS):
Apply protein cross-linkers to stabilize transient interactions
Immunoprecipitate complexes using anti-EXOC3L1 antibodies
Identify crosslinked peptides by mass spectrometry
Generate structural models of EXOC3L1 within the exocyst complex
Validate key interaction sites through targeted mutagenesis
These approaches would help elucidate EXOC3L1's precise role within the exocyst complex, which is essential for understanding its function in both normal cellular processes and disease states.