exoc3l1 Antibody

Shipped with Ice Packs
In Stock

Description

Antibody Characteristics

The EXOC3L1 antibody (Product ID: HPA029574) is a polyclonal rabbit-derived antibody produced by Sigma-Aldrich as part of their Prestige Antibodies® line. Key specifications include:

  • Host species: Rabbit

  • Conjugate: Unconjugated

  • Form: Affinity-isolated antibody in buffered aqueous glycerol solution

  • Reactivity: Human-specific

  • Applications: Immunohistochemistry (1:200–1:500 dilution)

  • Immunogen sequence: A 123-amino acid peptide (MGSLELGPEADVSQLEPLLTLENIEQLEATFVANIQASVSQWLQNALDGEVAEWGREHGPNTDPSGSYYSPMPAIVLQILEENIRVASLVSESLQQRVHGMALSELGTFLRSFSDALIRFSRDHFRGKSMAPHYVPYL) .

Cancer Prognosis and Biomarker Potential

EXOC3L1 is overexpressed in ESCC and correlates with poor clinical outcomes:

ParameterESCC Association
N stagePositive correlation (lymph node metastasis)
Pathologic stageSignificant association
Immune infiltrationLinked to CD8+ T cells, dendritic cells, and regulatory T cells

Role in Secretory Pathways

The exocyst complex, including EXOC3L1, is essential for constitutive secretion:

  • Knockout studies: CRISPR-Cas9 KO of EXOC3 in HeLa cells reduced secretion of soluble proteins (e.g., TIMP2, CST3) by >50% .

  • Professional secretory cells:

    • Adipocytes: Exoc3 knockdown decreased leptin secretion by 40% .

    • Myeloma cells: EXOC3L1 depletion reduced IgG antibody secretion (p < 0.01) .

Pan-Cancer Analysis

EXOC3L1 exhibits differential expression across 33 tumor types (TCGA data):

  • Upregulated: ESCC, glioblastoma, and pancreatic adenocarcinoma.

  • Downregulated: Kidney chromophobe and thyroid carcinoma .

  • Immune correlations: Positive associations with B cells, macrophages, and CD4+/CD8+ T cells in multiple cancers .

Cancer TypeImmune Correlation
ESCCActivated dendritic cells (r = 0.32)
Lung adenocarcinomaCytotoxic cells (r = 0.28)
Breast cancerTh1 cells (r = 0.24)

Technical Validation

The antibody has been validated through:

  • Protein Atlas: Immunohistochemical staining confirmed EXOC3L1 localization in vascular endothelial cells and tumor stroma .

  • Functional assays: Used in loss-of-function studies to characterize EXOC3L1’s role in exocytosis .

Future Directions

EXOC3L1 antibody is critical for exploring:

  • Therapeutic targeting: Potential for inhibiting lymph node metastasis in ESCC .

  • Immune microenvironment modulation: Mechanistic studies on EXOC3L1-driven immune evasion .

  • Broad-spectrum secretion pathways: Impact on hormone and cytokine release in non-cancer contexts .

Product Specs

Buffer
Preservative: 0.03% Proclin 300
Constituents: 50% Glycerol, 0.01M Phosphate Buffered Saline (PBS), pH 7.4
Form
Liquid
Lead Time
Made-to-order (14-16 weeks)
Synonyms
exoc3l1 antibody; si:ch211-51l3.1Exocyst complex component 3-like protein antibody
Target Names
exoc3l1
Uniprot No.

Target Background

Function
As a component of the exocyst complex, exoc3l1 may play a role in the regulation of exocytosis.
Database Links
Protein Families
SEC6 family
Subcellular Location
Cytoplasmic vesicle, secretory vesicle.

Q&A

What is EXOC3L1 and why is it important in cancer research?

EXOC3L1 (Exocyst complex component 3-like 1) is a protein-coding RNA located on chromosome 16 (16q22.1), also known as EXOC3L. It was originally identified as an isoform of Sec6 involved in insulin secretion regulation in pancreatic β cells . Recent research has revealed its significant overexpression in esophageal squamous cell carcinoma (ESCC) compared to normal tissues, with high expression correlating with worse prognosis . EXOC3L1 has demonstrated potential as a novel prognostic biomarker and therapeutic target in ESCC, particularly due to its association with lymph node metastasis (N stage) and pathologic stage . The protein's correlation with immune cell infiltration suggests its involvement in tumor immune microenvironment modulation, making it a compelling target for cancer immunotherapy research .

How should I select the appropriate anti-EXOC3L1 antibody for my research?

When selecting an anti-EXOC3L1 antibody, consider these methodological factors:

  • Validation status: Choose antibodies validated for your specific application (IHC, ICC-IF, WB) . Review validation data including positive/negative controls.

  • Species reactivity: Confirm the antibody recognizes EXOC3L1 in your experimental species. The antibody described in search result targets human EXOC3L1.

  • Epitope recognition: If studying specific domains or isoforms of EXOC3L1, verify the epitope region recognized by the antibody.

  • Polyclonal vs. monoclonal: Polyclonal antibodies (like the one in search result ) recognize multiple epitopes and may provide stronger signals, while monoclonals offer greater specificity for a single epitope.

  • Reproducibility: Assess the manufacturing process and quality control that ensures consistent lot-to-lot performance .

For ESCC or cancer-related research, select antibodies specifically validated in oncology applications, as EXOC3L1's role has been primarily characterized in ESCC contexts .

What are the optimal protocols for detecting EXOC3L1 in different tissue types?

Optimizing EXOC3L1 detection requires tissue-specific protocol adjustments:

For IHC in ESCC tissues:

  • Fixation: 10% neutral buffered formalin for 24-48 hours

  • Antigen retrieval: Heat-induced epitope retrieval in citrate buffer (pH 6.0) for 20 minutes

  • Blocking: 5% normal serum for 1 hour at room temperature

  • Primary antibody: Incubate with anti-EXOC3L1 antibody (0.1 mg/ml) at 1:100-1:200 dilution overnight at 4°C

  • Detection: Use appropriate secondary antibody and visualization system based on your primary antibody species and detection method

  • Controls: Include both positive controls (ESCC tissue with confirmed high EXOC3L1 expression) and negative controls (normal esophageal tissue)

For Western blotting:

  • Protein extraction: Use RIPA buffer with protease inhibitors

  • Loading: 20-40 μg total protein per lane

  • Transfer: Semi-dry or wet transfer to PVDF membrane

  • Blocking: 5% non-fat milk for 1 hour at room temperature

  • Primary antibody: Incubate with anti-EXOC3L1 antibody at manufacturer-recommended dilution (typically 1:500-1:1000) overnight at 4°C

  • Visualization: Use chemiluminescence detection after HRP-conjugated secondary antibody incubation

For immunofluorescence (ICC-IF):

  • Fixation: 4% paraformaldehyde for 15 minutes

  • Permeabilization: 0.1% Triton X-100 for 10 minutes

  • Blocking: 1% BSA for 30 minutes

  • Primary antibody: Anti-EXOC3L1 at 1:50-1:100 dilution for 1-2 hours at room temperature

  • Secondary antibody: Fluorophore-conjugated appropriate secondary antibody

How can I quantify EXOC3L1 expression levels accurately for prognostic studies?

For accurate EXOC3L1 quantification in prognostic studies, employ a multi-modal approach:

  • RNA-seq quantification:

    • Use normalized read counts or FPKM/TPM values

    • Establish expression thresholds based on population distribution (e.g., median split or quartiles)

    • For ESCC studies, utilize methodologies similar to those in published datasets (GTEx, TCGA, GEO)

  • IHC scoring systems:

    • Implement H-score methodology (intensity × percentage of positive cells)

    • Use automated image analysis software for objective quantification

    • Score intensity on a scale (0-3) and calculate percentage of positive cells

    • Consider both nuclear and cytoplasmic staining patterns

  • Statistical validation:

    • Correlate expression with clinicopathological features using appropriate statistical tests

    • Perform ROC curve analysis to determine optimal cutoff values (AUC for EXOC3L1 in ESCC was 0.812)

    • Use Kaplan-Meier survival analysis with log-rank test to assess prognostic significance

    • Conduct univariate and multivariate Cox regression analyses to determine independent prognostic value

  • Quality control measures:

    • Include technical replicates

    • Normalize to appropriate housekeeping genes/proteins

    • Use multiple antibody clones if available

    • Validate findings across independent cohorts

What are common challenges when working with EXOC3L1 antibodies and how can they be addressed?

Researchers commonly encounter these challenges with EXOC3L1 antibodies:

  • Cross-reactivity issues:

    • Problem: Non-specific binding to related exocyst complex proteins

    • Solution: Perform antibody validation with positive and negative controls, including EXOC3L1 knockdown/knockout samples

    • Approach: Use competition assays with recombinant EXOC3L1 protein to confirm specificity

  • Variable signal strength:

    • Problem: Inconsistent staining intensity between experiments

    • Solution: Standardize all protocol parameters (fixation times, antigen retrieval conditions, antibody concentrations)

    • Approach: Include internal reference controls in each experiment to normalize signal intensity

  • Limited tissue penetration:

    • Problem: Poor antibody penetration in thicker tissue sections

    • Solution: Optimize section thickness (4-5 μm recommended), extend antibody incubation times, or use specialized permeabilization protocols

    • Approach: Consider amplification methods like tyramide signal amplification for low-abundance targets

  • Background staining:

    • Problem: High background obscuring specific signals

    • Solution: Increase blocking time/concentration, optimize antibody dilution, and include additional washing steps

    • Approach: Use specialized blocking reagents that address tissue-specific background issues

  • Epitope masking:

    • Problem: Fixation-induced epitope masking

    • Solution: Evaluate multiple antigen retrieval methods (heat-induced vs. enzymatic)

    • Approach: Test different pH conditions (pH 6.0 citrate buffer vs. pH 9.0 EDTA buffer)

  • Lot-to-lot variability:

    • Problem: Performance differences between antibody lots

    • Solution: Purchase larger lots when possible and validate each new lot against previous standards

    • Approach: Maintain reference samples and standardized protocols for comparative testing

How can I validate the specificity of an anti-EXOC3L1 antibody?

A comprehensive validation strategy for anti-EXOC3L1 antibodies includes:

  • Genetic controls:

    • Perform siRNA/shRNA knockdown of EXOC3L1 to confirm signal reduction

    • Use CRISPR/Cas9-mediated knockout cells as negative controls

    • Overexpress EXOC3L1 in appropriate cell models to demonstrate signal increase

  • Multi-application concordance:

    • Verify consistent results across multiple applications (WB, IHC, ICC-IF)

    • Compare protein expression pattern with mRNA expression data

    • Confirm molecular weight in Western blot matches predicted size

  • Peptide competition assays:

    • Pre-incubate antibody with immunizing peptide or recombinant EXOC3L1

    • Demonstrate competitive reduction/elimination of specific signal

    • Include non-relevant peptide controls

  • Multiple antibody comparison:

    • Test multiple antibodies targeting different EXOC3L1 epitopes

    • Confirm consistent localization and expression patterns

    • Recognize that polyclonal antibodies like the one in result may show broader epitope recognition

  • Tissue panel analysis:

    • Examine expression across tissues with known EXOC3L1 expression profiles

    • Compare staining patterns with literature-described expression patterns

    • Include both normal and pathological tissues relevant to your research focus (e.g., normal esophageal tissues and ESCC samples)

How can EXOC3L1 antibodies be used to investigate its role in immune cell infiltration in cancer?

To investigate EXOC3L1's role in immune cell infiltration:

  • Multiplex immunofluorescence (mIF) studies:

    • Co-stain tissues with anti-EXOC3L1 antibody and markers for immune cells identified as significant in previous research: activated dendritic cells (aDCs), CD8+ T cells, cytotoxic cells, eosinophils, immature dendritic cells (iDCs), CD56dim Natural killer cells, T cells, Th1 cells, and regulatory T cells

    • Analyze co-localization patterns and spatial relationships

    • Quantify cell-to-cell distances and interaction frequencies

  • Flow cytometry applications:

    • Design multi-parameter panels including EXOC3L1 and immune cell markers

    • Sort EXOC3L1-high vs. EXOC3L1-low cells and perform comprehensive immune profiling

    • Analyze differences in immune populations associated with EXOC3L1 expression levels

  • Single-cell analysis workflows:

    • Integrate EXOC3L1 antibody staining with single-cell RNA sequencing

    • Map EXOC3L1 protein expression to transcriptional profiles of immune cells

    • Identify cell populations where EXOC3L1 expression correlates with immune function

  • Functional assays:

    • Use EXOC3L1 antibodies to neutralize or modulate protein function in co-culture systems

    • Assess changes in immune cell recruitment, activation, and function

    • Monitor cytokine production and immune checkpoint expression

  • In vivo imaging:

    • Develop conjugated EXOC3L1 antibodies for in vivo tracking

    • Visualize EXOC3L1-expressing cells and their interaction with immune infiltrates

    • Monitor dynamic changes in immune infiltration following therapeutic interventions

This approach aligns with research showing EXOC3L1 expression positively correlates with infiltration of several immune cell types in ESCC .

What are the most promising therapeutic applications targeting EXOC3L1 in cancer, and how can antibodies facilitate this research?

EXOC3L1 antibodies can advance cancer therapeutic research through:

  • Target validation studies:

    • Use antibodies to confirm EXOC3L1 overexpression in patient-derived xenografts and tissue microarrays

    • Correlate EXOC3L1 levels with response to standard therapies

    • Identify patient subgroups most likely to benefit from EXOC3L1-targeted approaches

    • Focus particularly on ESCC patients with lymph node metastasis, where EXOC3L1 shows significant correlation with N stage

  • Antibody-drug conjugate (ADC) development:

    • Engineer anti-EXOC3L1 antibodies conjugated to cytotoxic payloads

    • Optimize linker chemistry and payload selection

    • Evaluate specificity, internalization efficiency, and cytotoxic potency

    • Test ADCs in preclinical models of ESCC with varying EXOC3L1 expression levels

  • Combination therapy strategies:

    • Explore synergies between EXOC3L1 targeting and immune checkpoint inhibitors

    • Investigate EXOC3L1's role in PD-1 blockade response pathways identified in GSEA analysis

    • Develop rational combinations based on EXOC3L1's association with specific immune cell populations

    • Test combinatorial approaches in syngeneic mouse models

  • Biomarker implementation:

    • Develop standardized IHC protocols using validated anti-EXOC3L1 antibodies

    • Establish clinically relevant cutoffs for patient stratification

    • Create companion diagnostic assays for future EXOC3L1-targeting therapies

    • Implement in clinical trials to correlate expression with treatment outcomes

  • Mechanistic studies:

    • Use antibodies to identify EXOC3L1 binding partners through co-immunoprecipitation

    • Elucidate EXOC3L1's role in the PPI network identified in previous research

    • Investigate how EXOC3L1 influences cancer-related pathways

    • Develop structure-function insights to guide rational drug design

How can EXOC3L1 antibodies be applied in studies of metabolic disorders given its role in insulin secretion?

To investigate EXOC3L1's metabolic functions:

  • Pancreatic β-cell studies:

    • Use anti-EXOC3L1 antibodies to immunolocalize the protein in pancreatic islets

    • Study co-localization with insulin secretory granules and SNARE proteins

    • Investigate expression changes under diabetogenic conditions

    • Correlate EXOC3L1 expression with functional insulin secretion assays

  • Glucose stimulation experiments:

    • Monitor EXOC3L1 localization changes before and after glucose stimulation

    • Assess protein-protein interactions during insulin secretion using proximity ligation assays

    • Quantify differences in EXOC3L1 phosphorylation status under varying glucose concentrations

    • Determine EXOC3L1's temporal dynamics during biphasic insulin secretion

  • HDL metabolism investigations:

    • Examine EXOC3L1 expression in liver tissue using immunohistochemistry

    • Correlate tissue expression levels with serum HDL concentrations

    • Study EXOC3L1's potential interaction with HDL receptor complexes

    • Investigate its role in HDL-mediated cholesterol efflux pathways

  • Transgenic model analysis:

    • Generate tissue-specific EXOC3L1 knockout models

    • Use anti-EXOC3L1 antibodies to confirm deletion efficiency

    • Characterize metabolic phenotypes with emphasis on glucose homeostasis and lipid profiles

    • Perform rescue experiments with wild-type EXOC3L1

  • Therapeutic exploration:

    • Screen for compounds that modulate EXOC3L1 expression or function

    • Validate target engagement using anti-EXOC3L1 antibodies

    • Assess effects on insulin secretion and HDL metabolism

    • Develop antibody-based imaging tools to monitor therapy response

This research direction builds on EXOC3L1's established roles in insulin secretion and HDL concentration regulation , expanding its potential significance beyond cancer research.

What methodological approaches can detect interactions between EXOC3L1 and other exocyst complex components?

To study EXOC3L1's interactions with exocyst complex components:

  • Co-immunoprecipitation (Co-IP) optimization:

    • Use anti-EXOC3L1 antibodies as bait to pull down interacting partners

    • Implement reciprocal Co-IPs with antibodies against other exocyst components

    • Optimize lysis conditions to preserve native protein complexes

    • Validate interactions using multiple antibodies targeting different epitopes

    • Analyze precipitates by mass spectrometry to identify novel interactors

  • Proximity-based interaction assays:

    • Implement BioID or APEX2 proximity labeling with EXOC3L1 as the bait

    • Use anti-EXOC3L1 antibodies to validate expression of fusion proteins

    • Apply FRET/BRET approaches to study dynamic interactions

    • Perform proximity ligation assays (PLA) in fixed cells or tissues

    • Quantify interaction signals under various cellular conditions

  • Super-resolution microscopy techniques:

    • Utilize STORM/PALM imaging with EXOC3L1 antibodies

    • Perform two-color super-resolution to visualize nanoscale proximity

    • Track co-localization dynamics during vesicle trafficking events

    • Quantify spatial relationships at exocytosis sites

    • Correlate structural arrangements with functional outcomes

  • Protein fragment complementation assays:

    • Design split reporter systems fused to EXOC3L1 and potential partners

    • Validate expression using anti-EXOC3L1 antibodies

    • Measure reconstituted activity under various cellular conditions

    • Map interaction domains through deletion mutants

    • Assess effects of disease-associated mutations on complex formation

  • Cross-linking mass spectrometry (XL-MS):

    • Apply protein cross-linkers to stabilize transient interactions

    • Immunoprecipitate complexes using anti-EXOC3L1 antibodies

    • Identify crosslinked peptides by mass spectrometry

    • Generate structural models of EXOC3L1 within the exocyst complex

    • Validate key interaction sites through targeted mutagenesis

These approaches would help elucidate EXOC3L1's precise role within the exocyst complex, which is essential for understanding its function in both normal cellular processes and disease states.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.