fam149b1 Antibody

What is FAM149B1 and why is it significant for researchers?

FAM149B1 (Family with sequence similarity 149, member B1) encodes a protein with largely unknown function that has recently been implicated in ciliary biology. Its significance stems from research showing that mutations in this gene can lead to ciliopathy phenotypes in humans, particularly along the spectrum of Joubert syndrome, characterized by hypotonia, developmental delay, typical facies, oculomotor apraxia, polydactyly, and subtle posterior fossa abnormalities . In experimental settings, FAM149B1 deficiency has been associated with abnormal accumulation of IFT complex at the distal tips of cilia, increased ciliary length, and dysregulated SHH signaling, suggesting important roles in ciliary function .

What types of FAM149B1 antibodies are available for research applications?

Currently, researchers can access polyclonal antibodies for FAM149B1, such as those developed through the Human Protein Atlas project. The commercially available HPA039189 is an affinity-isolated antibody produced in rabbits . This antibody is typically provided in a buffered aqueous glycerol solution and is supplied in unconjugated form for flexibility in experimental design . When selecting an antibody, researchers should consider the specific applications they intend to use it for, as validation may vary between applications.

What are the recommended applications for FAM149B1 antibodies?

Based on available validation data, FAM149B1 antibodies are primarily recommended for:

• Immunoblotting (Western blotting) at concentrations of 0.04-0.4 μg/mL

• Immunohistochemistry at dilutions of 1:200-1:500

These applications allow researchers to detect the presence, localization, and relative abundance of FAM149B1 in tissue samples and cell lysates. When planning experiments, researchers should pilot test the antibody in their specific experimental system to determine optimal working conditions.

What is the immunogen sequence used for generating FAM149B1 antibodies?

The immunogen sequence commonly used for generating FAM149B1 antibodies is:

ERDSTIFGIRGKKLHFSSSYAHKASSIAKSSSFCSMERDEEDSIIVSEGIIEEYLAFDHIDIEEG

Understanding this sequence is important for researchers as it helps identify which region of the FAM149B1 protein the antibody recognizes. This can be particularly relevant when studying variants, truncated forms, or when designing blocking experiments.

How can FAM149B1 antibodies be optimized for studying cilia-related abnormalities?

When studying cilia-related abnormalities using FAM149B1 antibodies, researchers should consider implementing a dual immunostaining approach. Combine FAM149B1 antibody with established ciliary markers such as acetylated α-tubulin or ARL13B to effectively visualize the localization of FAM149B1 within the ciliary structure.

For optimal results when investigating ciliary phenotypes:

• Use serum starvation (0.5% FBS for 24-48 hours) to induce ciliogenesis before fixation

• Apply a gentle fixation protocol (4% paraformaldehyde for 10 minutes at room temperature) to preserve ciliary structures

• Include detergent permeabilization steps optimized for ciliary proteins

• Consider using super-resolution microscopy techniques to precisely localize FAM149B1 within ciliary subcompartments

Research has demonstrated that FAM149B1 deficiency results in abnormal accumulation of IFT complex at the distal tips of the cilia, which assume a bulbous appearance, and increased length of the primary cilium . These phenotypes can be quantitatively assessed using image analysis software to measure ciliary length and morphology in control versus experimental conditions.

What controls should be implemented when using FAM149B1 antibodies for immunostaining experiments?

For rigorous immunostaining experiments with FAM149B1 antibodies, implement these essential controls:

• Negative controls:

  • Secondary antibody-only controls to assess non-specific binding

  • Immunostaining in FAM149B1 knockout/knockdown cells to confirm antibody specificity

  • Pre-absorption controls using the immunizing peptide

• Positive controls:

  • Tissues or cell lines with confirmed FAM149B1 expression

  • Co-localization with known interacting proteins or ciliary markers

• Validation controls:

  • Correlation between immunostaining results and other detection methods (western blotting, RT-PCR)

  • Comparison of staining patterns between different FAM149B1 antibodies (if available)

A methodological approach involves using fibroblasts from patients with FAM149B1 mutations alongside control fibroblasts, as has been demonstrated in research identifying abnormal ciliary phenotypes . This provides an excellent biological system to validate antibody specificity while simultaneously investigating functional consequences of FAM149B1 deficiency.

How can researchers use FAM149B1 antibodies to investigate the relationship between FAM149B1 and SHH signaling?

To investigate the relationship between FAM149B1 and Sonic Hedgehog (SHH) signaling, researchers can employ the following methodological approach:

• Baseline comparison:

  • Use FAM149B1 antibodies to compare protein localization in cells with normal versus dysregulated SHH signaling

  • Quantify co-localization with key SHH pathway components (Smoothened, Gli proteins)

• Stimulation experiments:

  • Treat cells with SHH pathway agonists (e.g., SAG) or antagonists (e.g., cyclopamine)

  • Monitor changes in FAM149B1 localization or expression using the antibody

  • Compare responses between wild-type cells and FAM149B1 mutant/knockdown cells

• Functional readouts:

  • Measure Gli1/2/3 translocation to cilia and nuclei following SHH stimulation

  • Quantify expression of SHH target genes by qRT-PCR

  • Assess ciliary trafficking of SHH components using live-cell imaging

Research has shown that FAM149B1-deficient cells exhibit dysregulated SHH signaling , suggesting a functional link between FAM149B1 and this pathway. Using FAM149B1 antibodies in combination with SHH pathway markers can help elucidate the molecular mechanisms underlying this relationship.

What are the common troubleshooting steps for non-specific binding or weak signal when using FAM149B1 antibodies?

When encountering non-specific binding or weak signal issues with FAM149B1 antibodies, implement these troubleshooting approaches:

For non-specific binding:

• Increase blocking stringency (try 5% BSA or 10% serum from the same species as secondary antibody)

• Optimize antibody dilution (test a range from 1:100 to 1:1000)

• Add 0.1-0.3% Triton X-100 to washing buffers to reduce hydrophobic interactions

• Include additional washing steps (minimum 3x15 minutes)

• Pre-absorb the antibody with the immunizing peptide to identify non-specific signals

For weak signal:

• Test antigen retrieval methods (heat-induced epitope retrieval or enzyme-based methods)

• Reduce washing stringency slightly

• Extend primary antibody incubation time (overnight at 4°C)

• Use signal amplification systems (tyramide signal amplification or poly-HRP conjugates)

• Ensure sample preservation by minimizing freeze-thaw cycles and using appropriate fixatives

The recommended working concentrations for FAM149B1 antibodies are 0.04-0.4 μg/mL for immunoblotting and 1:200-1:500 dilutions for immunohistochemistry . Deviation from these ranges may require additional optimization in your specific experimental system.

How should researchers interpret discrepancies between FAM149B1 antibody results and genetic data?

When faced with discrepancies between FAM149B1 antibody results and genetic data, follow this systematic investigation approach:

• Verify antibody specificity:

  • Perform knockdown/knockout validation

  • Test multiple antibodies targeting different epitopes

  • Confirm specificity using recombinant expression systems

• Consider protein-level regulatory mechanisms:

  • Investigate post-transcriptional regulation (miRNAs, RNA binding proteins)

  • Assess post-translational modifications that might affect antibody binding

  • Examine protein stability and degradation pathways

• Analyze possible technical limitations:

  • Evaluate epitope accessibility in different experimental conditions

  • Consider the impact of fixation and processing on epitope preservation

  • Assess whether detected signals represent full-length protein or fragments

• Examine biological explanations:

  • Investigate if genetic mutations affect protein expression or localization rather than function

  • Consider compensatory mechanisms that might mask phenotypes

  • Explore tissue-specific or developmental stage-specific regulation

In research involving FAM149B1 mutations, discrepancies might arise because truncating variants (such as those found in patients with Joubert syndrome) could still allow partial protein expression that may be detected by antibodies targeting N-terminal epitopes . Always verify which region of the protein your antibody recognizes relative to the mutations being studied.

How can FAM149B1 antibodies be used to investigate ciliary length regulation?

To study ciliary length regulation using FAM149B1 antibodies, implement this comprehensive experimental design:

• Baseline measurements:

  • Use dual immunostaining with acetylated α-tubulin and FAM149B1 antibodies

  • Measure ciliary length in multiple cell types (fibroblasts, RPE-1, IMCD3)

  • Quantify at least 100-200 cilia per condition using automated image analysis

• Genetic manipulation experiments:

  • Compare ciliary length between control and FAM149B1-deficient cells

  • Perform rescue experiments with wild-type and mutant FAM149B1 constructs

  • Create stable cell lines with inducible FAM149B1 expression

• Mechanistic investigations:

  • Examine localization of IFT proteins and kinesin/dynein motors

  • Monitor ciliary trafficking using fluorescent reporters

  • Assess tubulin post-translational modifications using specific antibodies

Research has shown that FAM149B1-deficient cells display increased ciliary length compared to control cells (3.9 μm versus 2.7-2.9 μm) . This phenotype can serve as a quantitative readout for interventions targeting FAM149B1 function. Additionally, monitoring the morphology of ciliary tips for bulbous appearance provides another quantifiable parameter affected by FAM149B1 deficiency.

What approach should be used when designing experiments to investigate FAM149B1's role in ciliopathies?

When designing experiments to investigate FAM149B1's role in ciliopathies, implement this translational research framework:

• Patient-derived materials:

  • Establish fibroblast cultures from patients with FAM149B1 mutations

  • Create iPSCs and differentiate into relevant cell types (neural, retinal, renal)

  • Analyze ciliary phenotypes across different patient-derived cells

• Model systems:

  • Generate FAM149B1 knockout/knockin animal models (zebrafish, mouse)

  • Create 3D organoid cultures to study tissue-specific phenotypes

  • Develop cell-based assays for ciliary function (e.g., hedgehog signaling)

• Phenotypic analysis:

  • Compare clinical features with cellular phenotypes

  • Assess developmental timing of ciliary defects

  • Evaluate tissue-specific manifestations of ciliary dysfunction

• Intervention testing:

  • Screen compounds that modify ciliary length or function

  • Test gene therapy or antisense oligonucleotide approaches

  • Evaluate small molecules targeting interacting proteins

Research has established a direct link between FAM149B1 mutations and ciliopathy phenotypes along the spectrum of Joubert syndrome and oral-facial-digital syndrome (OFD VI) . Patient-derived cells provide an invaluable resource for studying the functional consequences of these mutations and testing potential therapeutic interventions.

How can super-resolution microscopy enhance FAM149B1 antibody-based studies of ciliary function?

Super-resolution microscopy offers substantial advantages for FAM149B1 antibody-based ciliary research:

• Enhanced structural resolution:

  • Structured Illumination Microscopy (SIM) provides ~120 nm resolution to visualize ciliary subdomains

  • STED microscopy achieves ~30-50 nm resolution for detailed ciliary tip morphology

  • Single-molecule localization methods (PALM/STORM) enable ~20 nm precision for protein clustering analysis

• Methodological considerations:

  • Optimize fixation protocols to preserve nanoscale structures (PFA + glutaraldehyde mixtures)

  • Select appropriate fluorophores with photostability suitable for super-resolution techniques

  • Use quantum dots or DNA-PAINT for ultra-high precision multi-color imaging

• Advanced applications:

  • Implement 3D-STORM to map FAM149B1 distribution throughout ciliary volume

  • Use live-cell super-resolution techniques to track dynamic FAM149B1 behavior

  • Combine with expansion microscopy to physically magnify ciliary structures

For studying the bulbous ciliary tip phenotype associated with FAM149B1 deficiency , super-resolution approaches provide critical advantages over conventional microscopy by enabling precise measurement of IFT protein accumulation patterns and detailed morphological analysis of the ciliary tip compartment.

What are the best approaches for validating FAM149B1 antibody specificity for research applications?

To rigorously validate FAM149B1 antibody specificity, implement this comprehensive validation framework:

• Genetic validation:

  • Test antibody reactivity in CRISPR/Cas9 FAM149B1 knockout cells

  • Perform siRNA knockdown followed by antibody detection

  • Create epitope-tagged FAM149B1 constructs and assess co-localization

• Biochemical validation:

  • Conduct immunoprecipitation followed by mass spectrometry

  • Perform peptide competition assays using the immunizing peptide

  • Test cross-reactivity against related family members (e.g., FAM149A)

• Multi-method concordance:

  • Compare antibody results with RNA expression (RNA-seq, qRT-PCR)

  • Validate subcellular localization using fractionation methods

  • Confirm size of detected protein matches predicted molecular weight

• Application-specific validation:

  • For IHC: Include positive and negative tissue controls

  • For IF: Compare multiple fixation and permeabilization methods

  • For WB: Test reducing and non-reducing conditions

Researchers studying FAM149B1 mutations should be particularly cautious about antibody selection, as truncating mutations may affect epitope availability. For instance, the homozygous truncating variants (p.Gln147*) identified in patients with Joubert syndrome would eliminate most of the protein, including 90% of the DUF3719 domain (the predicted functional domain) . Antibodies targeting epitopes downstream of these mutation sites would be ineffective for detecting truncated proteins.