fam166b Antibody

Shipped with Ice Packs
In Stock

Description

Development and Validation of FAM166B Antibodies

Antibodies targeting FAM166B are primarily polyclonal, generated through immunization with synthetic peptides derived from the protein’s sequence. Key steps in their development include:

  • Immunogen Design: The immunogen for Sigma-Aldrich’s HPA045540 antibody, for example, includes the peptide sequence RAQFIFAKNCSQVWAEALSDFTHLHEKQGSEELPKEAKGRKDTEKDQVPEPEGQLEEPTLEVVEQASPYSMDDRDPRKFFMSGFTGYVPCARFLFGSSF .

  • Validation Methods:

    • Orthogonal Validation: Cross-checking antibody specificity using RNA-seq data from the Human Protein Atlas ensures consistency with gene expression profiles .

    • Western Blot: Tested on lysates from human tissues (e.g., adrenal gland, fallopian tube) to confirm target recognition .

    • Immunohistochemistry (IHC): Applied to cancer tissues (e.g., colorectal, breast) to map subcellular localization .

AntibodySourceApplicationsValidation
HPA045540Sigma-AldrichIHC (1:50–1:200), WBOrthogonal RNAseq
ABIN6753743Antibodies-OnlineWBPeptide array
Rabbit pAbBio-TechneIHC, WBEnhanced validation

Applications in Research

FAM166B antibodies are employed in diverse research areas:

  • Cancer Research:

    • Prognosis: High FAM166B expression correlates with survival outcomes in certain cancers (e.g., brain, respiratory tumors) .

    • Subcellular Localization: Antibodies reveal cytoplasmic or nuclear staining, aiding studies of protein trafficking .

  • Protein Interactions: Used in co-immunoprecipitation assays to identify binding partners, though no significant interactions have been reported to date .

  • Western Blotting: Detects the 30.6 kDa protein in lysates, confirming tissue-specific expression (adrenal gland, respiratory epithelia) .

Challenges and Future Directions

Despite advancements, challenges remain:

  • Limited Functional Data: FAM166B’s role in cellular processes is poorly understood, hindering antibody utility .

  • Cross-Reactivity: Polyclonal antibodies may exhibit off-target binding, necessitating rigorous validation .

Product Specs

Buffer
Preservative: 0.03% Proclin 300
Components: 50% Glycerol, 0.01M Phosphate Buffered Saline (PBS), pH 7.4
Form
Liquid
Lead Time
Made-to-order (14-16 weeks)
Synonyms
fam166b antibody; zgc:158652Protein FAM166B antibody
Target Names
fam166b
Uniprot No.

Q&A

What is FAM166B and what is known about its biological function?

FAM166B (family with sequence similarity 166, member B) is also known as hypothetical protein LOC730112 . It belongs to a family of proteins with sequence similarity, though its precise biological function remains under investigation. Current research indicates it is expressed in human tissues and may have cellular functional significance that warrants further investigation through antibody-based detection methods . When designing experiments to elucidate FAM166B function, researchers should consider:

  • Expression profiling across multiple tissue types using immunohistochemistry

  • Co-localization studies with known cellular markers

  • Knockdown or overexpression studies to observe phenotypic changes

  • Interaction studies to identify binding partners

What applications is the FAM166B antibody validated for?

The FAM166B polyclonal antibody has been validated for several important research applications:

  • Immunohistochemistry (IHC)

  • Immunohistochemistry-Paraffin (IHC-P)

  • Immunofluorescence (IF)

For optimal results in these applications, the antibody should be used within the validated dilution ranges. For immunohistochemistry and immunohistochemistry-paraffin applications, the recommended dilution range is 1:50 - 1:200 . When developing new protocols or adapting existing ones, these ranges serve as a starting point, with optimization recommended for each specific experimental context.

What species reactivity has been confirmed for the FAM166B antibody?

SpeciesApplicationsSourceProduct Type
HumanIHC, IHC-P, IFRabbitPolyclonal
HumanWestern BlotRabbitPolyclonal
Cow, Human, PigWestern BlotNot specifiedPolyclonal

When conducting cross-species studies, validation experiments should be performed to confirm specific reactivity in your model organism of interest. This validation might include positive and negative controls, as well as blocking peptide experiments to confirm specificity.

What are the optimal sample preparation protocols for different applications?

Sample preparation is critical for obtaining reliable results with FAM166B antibody. Based on the validated applications, here are methodological recommendations:

For Immunohistochemistry (Paraffin):

  • Fix tissues in 10% neutral buffered formalin for 24-48 hours

  • Process and embed in paraffin using standard protocols

  • Section tissues at 4-6 μm thickness

  • Deparaffinize and rehydrate sections

  • Perform heat-induced epitope retrieval (HIER) using citrate buffer (pH 6.0) or EDTA buffer (pH 9.0)

  • Block endogenous peroxidase activity with 3% hydrogen peroxide

  • Apply primary antibody at 1:50 - 1:200 dilution

  • Incubate at 4°C overnight or at room temperature for 1-2 hours

  • Apply appropriate detection system

  • Counterstain, dehydrate, and mount

For Immunofluorescence:

  • Fix cells in 4% paraformaldehyde for 15-20 minutes at room temperature

  • Permeabilize with 0.1-0.5% Triton X-100

  • Block with 1-5% normal serum from the same species as the secondary antibody

  • Apply primary antibody at appropriate dilution

  • Incubate at 4°C overnight or at room temperature for 1-2 hours

  • Apply fluorophore-conjugated secondary antibody

  • Counterstain nuclei and mount with anti-fade mounting medium

What are potential troubleshooting strategies for inconsistent results?

When experiencing inconsistent results with FAM166B antibody, consider the following methodological troubleshooting approaches:

IssuePotential CausesTroubleshooting Strategies
Weak or no signalInsufficient antibody concentrationIncrease antibody concentration within recommended range (1:50 - 1:200)
Inadequate antigen retrievalOptimize antigen retrieval method (pH, duration, temperature)
Protein degradationUse fresher samples, add protease inhibitors
High backgroundExcessive antibody concentrationReduce antibody concentration
Insufficient blockingIncrease blocking duration or use alternative blocking reagent
Cross-reactivityPerform additional specificity controls
Non-specific stainingSecondary antibody cross-reactivityUse secondary antibody raised against the host species (rabbit)
Endogenous enzyme activityEnsure complete quenching of endogenous peroxidase/phosphatase
Variability between experimentsInconsistent protocol executionStandardize protocols and minimize variations
Antibody storage issuesStore according to recommendations (4°C short term, -20°C long term)

How should FAM166B antibody be stored to maintain optimal activity?

For optimal antibody performance, follow these storage recommendations:

  • Store at 4°C for short-term usage (days to weeks)

  • Aliquot and store at -20°C for long-term storage (months to years)

  • Avoid repeated freeze-thaw cycles that can degrade antibody quality and performance

  • The antibody is supplied in PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide, which helps maintain stability

What controls should be included in experiments using FAM166B antibody?

Rigorous experimental design requires appropriate controls to ensure result validity:

Positive Controls:

  • Human tissues or cell lines known to express FAM166B

  • Recombinant FAM166B protein expression systems

Negative Controls:

  • Tissues known not to express FAM166B

  • Isotype control antibody (rabbit IgG at equivalent concentration)

  • Primary antibody omission

  • Blocking peptide competition (using the immunogen sequence)

Technical Controls:

  • Standardized positive control samples run across experimental batches

  • Dilution series to establish optimal antibody concentration

  • Multiple detection methods to confirm findings

How can FAM166B antibody be used in multiplex immunostaining?

For researchers investigating complex tissue architectures or protein interactions, multiplex staining provides valuable contextual information:

  • Panel Selection:

    • Choose antibodies raised in different host species

    • If using multiple rabbit antibodies, employ sequential staining with thorough blocking between rounds

    • Consider tyramide signal amplification (TSA) systems for same-species antibodies

  • Methodological Approach:

    • Begin with the lowest abundance target (likely FAM166B)

    • Use spectral unmixing if fluorescent wavelengths have overlap

    • Consider chromogenic multiplex IHC for long-term slide stability

  • Validation Strategy:

    • Test each antibody individually before combining

    • Include single-stained controls for establishing specificity

    • Perform blocking studies to ensure no cross-reactivity between detection systems

What quantitative analysis methods are appropriate for FAM166B expression studies?

When moving beyond qualitative assessment to quantitative analysis of FAM166B expression:

  • Image Analysis Techniques:

    • Digital image analysis using thresholding and segmentation

    • H-score method (combining intensity and percentage positive cells)

    • Automated whole slide imaging with algorithm-based quantification

  • Expression Level Quantification:

    • Semiquantitative scoring (0, 1+, 2+, 3+)

    • Quantitative immunofluorescence using standardized fluorescent units

    • Comparative expression across tissue types or disease states

  • Statistical Approaches:

    • Non-parametric tests for semiquantitative scoring data

    • ANOVA or t-tests for continuous measurement data

    • Correlation analysis with clinical parameters or other biomarkers

What is known about FAM166B expression patterns in normal and pathological tissues?

Understanding expression patterns provides important context for research applications:

Normal Tissues:

  • While specific expression data for FAM166B is limited in the search results, the antibody has been validated for human tissue detection

  • The Human Protein Atlas project may provide additional expression data through comprehensive tissue microarrays

Pathological Tissues:

  • Research into FAM166B expression in disease states is ongoing

  • Consider exploring:

    • Expression changes in malignant versus normal tissues

    • Correlation with prognostic or diagnostic parameters

    • Association with specific cellular phenotypes or pathways

What are emerging research applications for FAM166B antibody?

As research into FAM166B continues to evolve, several promising applications show potential:

  • Single-cell Analysis:

    • Investigation of FAM166B expression heterogeneity within tissues

    • Correlation with cell type-specific markers in complex tissues

    • Integration with genomic and transcriptomic data

  • Therapeutic Target Validation:

    • Evaluation of FAM166B as a potential biomarker

    • Expression analysis in response to experimental therapeutics

    • Structure-function relationship studies

  • Developmental Biology:

    • Expression patterns during tissue development and differentiation

    • Temporal and spatial regulation studies

    • Comparative analysis across model organisms to understand evolutionary conservation

How should protocols be modified for detecting low-abundance FAM166B expression?

When FAM166B is expressed at low levels, standard protocols may require modification:

  • Signal Amplification Methods:

    • Tyramide signal amplification (TSA) to enhance sensitivity

    • Polymer-based detection systems instead of traditional ABC methods

    • Extended primary antibody incubation (overnight at 4°C)

    • Higher primary antibody concentration (closer to 1:50 dilution)

  • Sample Preparation Considerations:

    • Optimized fixation to preserve epitope integrity

    • Enhanced antigen retrieval methods (higher temperature, longer duration)

    • Use of specialized permeabilization protocols for difficult tissues

  • Detection Strategy:

    • Consider fluorescence-based detection for improved signal-to-noise ratio

    • Use confocal microscopy to reduce background interference

    • Employ image stacking or deconvolution for signal enhancement

What methodological adaptations are needed for different tissue types?

Different tissue types present unique challenges requiring protocol adjustments:

Tissue TypeMethodological Considerations
BrainLonger fixation time, specialized antigen retrieval
MuscleEnhanced permeabilization, extended primary antibody incubation
AdiposeReduced temperature during processing to prevent lipid loss
Fibrotic TissuesMore aggressive antigen retrieval, consideration of enzyme digestion
Highly VascularizedAdditional blocking of endogenous biotin and peroxidase

For all tissue types, preliminary optimization experiments should determine the ideal protocol parameters for detecting FAM166B with clarity and specificity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.